DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hus1-like and HUS1B

DIOPT Version :8

Sequence 1:NP_001262267.1 Gene:Hus1-like / 40598 FlyBaseID:FBgn0026417 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_683762.2 Gene:HUS1B / 135458 HGNCID:16485 Length:278 Species:Homo sapiens

Alignment Length:300 Identity:76/300 (25%)
Similarity:136/300 (45%) Gaps:46/300 (15%)


  Fly     1 MKFRALMQDPLYMKEFQAIVATLTKLAKDCVMIL----------GSRQMHFIVNEDQSSAASPLV 55
            |||||.:.....::.|..:..|:.:|||.||:.:          ||..:|           ...:
Human     1 MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLH-----------EARL 54

  Fly    56 WAGITAEEYFPEYRMEAAHPDQEYIVLGVSSANLGRALSVLRGGGVNSCKLKLQRIQFPCISVIA 120
            |..: .:..|.::|||....|.:.|.|.:::.:|.||  .....|.:|.||:|...:.|.::| |
Human    55 WCEV-RQGAFQQFRMEGVSEDLDEIHLELTAEHLSRA--ARSAAGASSLKLQLTHKRRPSLTV-A 115

  Fly   121 SVLTSSSTEAREVVHDVPVTIIPGSDWSAYVVPRVPNSQLALGLPSLRLLKSLIDKLKNISPSLE 185
            ..|.||...||.||||:||.::|...|...:.|.:..|..::.||..|.|:|:::::.|:...:.
Human   116 VELVSSLGRARSVVHDLPVRVLPRRVWRDCLPPSLRASDASIRLPRWRTLRSIVERMANVGSHVL 180

  Fly   186 FQVNVDGELNVIATSEMSTVTSRFQKLLIRTVSGSQQEASCS--------------VDSRKASAF 236
            .:.|:.|.:.:...:|:.::.|.|:.|      |:..:::..              ||:||...|
Human   181 VEANLSGRMTLSIETEVVSIQSYFKNL------GNPPQSAVGVPENRDLESMVQVRVDNRKLLQF 239

  Fly   237 FGALQLPNEELTIGIDREHSIHLQIDVRQDVVLHSILPAV 276
            ....|:........|.....:.|.: |::||.|...:||:
Human   240 LEGQQIHPTTALCNIWDNTLLQLVL-VQEDVSLQYFIPAL 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hus1-likeNP_001262267.1 Hus1 1..277 CDD:281934 76/300 (25%)
HUS1BNP_683762.2 Hus1 1..278 CDD:281934 76/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C226843952
eggNOG 1 0.900 E1_KOG3999
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4452
Isobase 1 0.950 0 Normalized mean entropy S5411
OMA 1 1.010
OrthoDB 1 1.010 D1053181at2759
OrthoFinder 1 1.000 FOG0002407
OrthoInspector 1 1.000 T609939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12900
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.