DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14655 and Maz

Sequence 1:NP_649494.1 Gene:CG14655 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001103789.1 Gene:Maz RGDID:1594632 Length:477 Species:Rattus norvegicus

Alignment Length:482 Identity:118/483 (24%)
Similarity:174/483 (36%) Gaps:93/483 (19%)


  Fly    24 QRLIKAANGPLACPFANCKELFLGLDKLTIHLFSHTSLMAQEGNESPANGQPASSRGFLAAAPPK 88
            |...:||..|...|.|...|. |.:|.|.:        :|.....:.|....|::...:..|||.
  Rat    60 QSPFQAAPAPPPTPQAPAAEP-LQVDLLPV--------LAAAQESAAAAAAAAAAAAAVVTAPPA 115

  Fly    89 RRAKRT------RSKPVVPTPPP------VRTTPPAHCDICEFSFRNTELRDMHVRLVHENAEGE 141
            ..|..|      :..|..|.|||      ....|||.......:.....:.......|      .
  Rat   116 PAAASTVDTAALKQPPAPPPPPPAVSAPAAEAAPPAAAATIAAAAATAVVAPTSTVAV------A 174

  Fly   142 PKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPT--PASTTS 204
            |.....::|...:.||.|.||:|.|:...:||.| :.:| .|.............||  |.|..|
  Rat   175 PVASVLEKKTKSKGPYICALCAKEFKNGYNLRRH-EAIH-TGAKAGRVPSGAMKMPTMVPLSLLS 237

  Fly   205 AVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWECD 269
                .|:||          ||.|.|..:..........:|.:      .::..||....|...|:
  Rat   238 ----VPQLS----------GASGGGGEAGAGGGTAAVAAGGV------VTTTASGKRIRKNHACE 282

  Fly   270 VCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEV--KPHVCGVCGRAFK 332
            :|.|:|...|.|.:||..|:.|.||.|.:|.:.|..:.....|:..|...  ||:.|..||::|.
  Rat   283 MCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFS 347

  Fly   333 ELSTLHNHQR-IHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTF-------RY 389
            ....|::|.| :||.|:|||||.|...|..:.....||..|...:|  |.:|.|..       ..
  Rat   348 RPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVP--CHVCGKMLSSAYISDHM 410

  Fly   390 KVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAAINSSSIVDPEQEALLSQSIDDI 454
            ||          .:|.|..:.:...:|. ....|..|:|..||..::::|.....|:        
  Rat   411 KV----------HSQGPHHVCELCNKGT-GEVCPMAAAAAAAAAAAAAVVAAPPTAV-------- 456

  Fly   455 VVEQCQKLGICGVEPREEGQLISLQPV 481
                       |.....||..:|.||:
  Rat   457 -----------GTLSGAEGVPVSSQPL 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 8/20 (40%)
zf-H2C2_2 281..304 CDD:290200 10/23 (43%)
C2H2 Zn finger 324..344 CDD:275368 7/21 (33%)
zf-H2C2_2 339..361 CDD:290200 12/23 (52%)
C2H2 Zn finger 352..372 CDD:275368 6/20 (30%)
zf-H2C2_2 364..389 CDD:290200 7/32 (22%)
C2H2 Zn finger 380..396 CDD:275368 5/23 (22%)
MazNP_001103789.1 C2H2 Zn finger 192..212 CDD:275368 8/21 (38%)
C2H2 Zn finger 281..301 CDD:275368 8/20 (40%)
zf-H2C2_2 293..318 CDD:290200 10/25 (40%)
C2H2 Zn finger 309..329 CDD:275368 4/20 (20%)
zf-C2H2 337..357 CDD:278523 6/20 (30%)
C2H2 Zn finger 339..357 CDD:275368 6/18 (33%)
C2H2 Zn finger 368..388 CDD:275368 6/20 (30%)
C2H2 Zn finger 394..413 CDD:275368 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.