DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14655 and Bcl6b

Sequence 1:NP_649494.1 Gene:CG14655 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001101749.1 Gene:Bcl6b RGDID:1563179 Length:472 Species:Rattus norvegicus

Alignment Length:345 Identity:96/346 (28%)
Similarity:140/346 (40%) Gaps:68/346 (20%)


  Fly    82 LAAAPPKRRAKRTRSKPVVPTPPPVRTT-----PPAHCDICEFSFRNTELRDMHVRLVHENAEGE 141
            :.|.||:        .|.||.|...|.:     ||.....|                    ::|.
  Rat   145 MEAEPPR--------PPTVPPPGSPRRSEGHPDPPTESRSC--------------------SQGS 181

  Fly   142 PKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPN-PNPNPSPTPASTTSA 205
            |....|..|..:.:.||..:.:......|||     .....|.||.... |:.:.:.:.:|::|:
  Rat   182 PSPASPDPKACNWKKYKFIVLNSQSSQAGSL-----AGESSGQPCPQARLPSGDEACSSSSSSSS 241

  Fly   206 VT-ATP----KLSICDRIRHTEPGALGNGN------------------NSTCTASQP-YALSGAL 246
            .. |||    :||:.......:.|||.|.:                  .|.|.:.|. .|::|..
  Rat   242 EEGATPGLQSRLSLATTTARFKCGALANNSYLFTPPAQETSKQAHPPPGSECLSCQNCEAVAGCS 306

  Fly   247 SMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHK 311
            |.::  |.:|..   ..|.::|.:|..:|..|..|..|:.:||||.||.|.:|...|....:...
  Rat   307 SGIE--PLAPGD---EDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPYRCSVCGARFNRPANLKT 366

  Fly   312 HLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVM 376
            |...||..||:.|..||..|.:::.|..|..||:||||:.|..||..||...:...|.|||||..
  Rat   367 HSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQTLKSHVRIHTGEK 431

  Fly   377 PYKCELCQKTFRYKVSQRTH 396
            ||.|:.|...||:|...|.|
  Rat   432 PYHCDPCGLHFRHKSQLRLH 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 6/20 (30%)
zf-H2C2_2 281..304 CDD:290200 11/23 (48%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
zf-H2C2_2 339..361 CDD:290200 12/22 (55%)
C2H2 Zn finger 352..372 CDD:275368 8/20 (40%)
zf-H2C2_2 364..389 CDD:290200 12/25 (48%)
C2H2 Zn finger 380..396 CDD:275368 6/16 (38%)
Bcl6bNP_001101749.1 BTB 28..132 CDD:279045
BTB 39..131 CDD:197585
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
zf-H2C2_2 335..360 CDD:290200 11/25 (44%)
C2H2 Zn finger 351..371 CDD:275368 4/20 (20%)
zf-H2C2_2 363..388 CDD:290200 9/25 (36%)
C2H2 Zn finger 379..399 CDD:275368 7/20 (35%)
zf-H2C2_2 391..416 CDD:290200 13/25 (52%)
C2H2 Zn finger 407..427 CDD:275368 8/20 (40%)
zf-H2C2_2 420..444 CDD:290200 12/24 (50%)
C2H2 Zn finger 435..453 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4138
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.