DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14655 and CG33213

Sequence 1:NP_649494.1 Gene:CG14655 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_788749.1 Gene:CG33213 FlyBaseID:FBgn0053213 Length:341 Species:Drosophila melanogaster

Alignment Length:365 Identity:74/366 (20%)
Similarity:118/366 (32%) Gaps:95/366 (26%)


  Fly    73 GQPASSRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFR------NTELRDMHV 131
            |||.|     |..||:....:.:|.|:     ||...|...|...::..|      ...::::|.
  Fly    13 GQPIS-----AGKPPRHSPVQMKSIPL-----PVFELPEYVCVETKWVTRKYAIENGIPVKELHA 67

  Fly   132 RLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPN-PNP 195
            .:.:..|...|| |..|||..::........:...|.:.:::.........|:.|...:.. ..|
  Fly    68 PITNGGATESPK-KSVQQKRLNEVTGMFANEAMVPRRERAIQTENAGTKDAGIQCRRDSEEWYLP 131

  Fly   196 SPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGT 260
            ...|..|.|..:.:.|.                                 |:.:.::.....:| 
  Fly   132 EERPKDTGSEASNSDKF---------------------------------LTYVSENTFIFPNG- 162

  Fly   261 ATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVK----- 320
                :.||.||.....|....:.|...|.|. ...|..|.:....|:...:|.|....:.     
  Fly   163 ----MMECAVCGDVAKTLLEHQSHMTAHYGP-GALCFRCGQRLDHQKQLKQHSLSCPALAPRKSS 222

  Fly   321 -----PHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHT----------- 369
                 ||:  :|.........|..|.|.|||.|.::|..|.:.|:...|.|||.           
  Fly   223 MLFKCPHL--LCNAMSHSEMQLLRHLRNHSGRKCYRCLQCKRYFKTTTSLLVHRKKEQSCAKAKV 285

  Fly   370 ----RIHTGVM-----PYKCELCQKTFRYKVSQRT---HR 397
                |.|.|:.     |.:|.:|.|.|.   |:|.   ||
  Fly   286 VVLFREHNGLPNGRGDPRRCSVCLKRFS---SERVCLRHR 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 5/20 (25%)
zf-H2C2_2 281..304 CDD:290200 5/23 (22%)
C2H2 Zn finger 324..344 CDD:275368 4/20 (20%)
zf-H2C2_2 339..361 CDD:290200 9/22 (41%)
C2H2 Zn finger 352..372 CDD:275368 8/35 (23%)
zf-H2C2_2 364..389 CDD:290200 12/45 (27%)
C2H2 Zn finger 380..396 CDD:275368 6/19 (32%)
CG33213NP_788749.1 C2H2 Zn finger 257..292 CDD:275368 8/35 (23%)
C2H2 Zn finger 305..323 CDD:275368 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.