DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14655 and Cf2

Sequence 1:NP_649494.1 Gene:CG14655 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster

Alignment Length:448 Identity:111/449 (25%)
Similarity:171/449 (38%) Gaps:126/449 (28%)


  Fly     8 CPLC--------------------AVPSFGSIDALQQRLIKAANGP-LACPFANCKELF---LGL 48
            ||:|                    .:.:.|:|..|.....:|...| |:.|..||.|.|   :.|
  Fly    76 CPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPKLSHPCFNCDEKFGNAVDL 140

  Fly    49 DKLTIHLFSHTS-------LMAQEGNESPANGQP------------------ASSRGFL----AA 84
            |:  .|..:|.:       ||........|..||                  |..:||:    ||
  Fly   141 DE--HHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAA 203

  Fly    85 APPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELR-DMHVRLVHENAEGEPKQK--- 145
            ..|..:.      |.: .|..:|.||       |......:|: :.|.:..|:..:.:.:|:   
  Fly   204 VTPDDQL------PAM-APRDMRLTP-------EEQHHQQQLQAEHHHQQQHQQQQQQQQQQQEL 254

  Fly   146 -EPQQKEPDQ--EPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVT 207
             |.||:|..:  :..:.|...:...:.|. ::.||      ||......|.|      :...|:.
  Fly   255 LEQQQREMQEQAQQQQVHHHQQDQDLAGD-QVALK------VPPLTVKLNKN------ANGGAIV 306

  Fly   208 ATPKLSICDRIRHTEPGALGNGNNSTCTASQP-YALSGALSMLQQSPSSPES-------GTATPK 264
            :.|::.|.:     ||.:|.:..:  ...|.| ||       :|.:|..|..       ||.|..
  Fly   307 SHPQVIIKE-----EPLSLSDSGD--VVNSVPVYA-------IQANPGVPAPASSGVLVGTQTVP 357

  Fly   265 L-------WECDVCSKSFTTKYFLKKHKRLHTG-------EMPYTCEICARTFTFQQSYHKHLLY 315
            .       .:|..|.|:|.|...|..|:::|||       |.||||..|.::||...:..:|...
  Fly   358 ADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI 422

  Fly   316 HSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVH-TRIH 372
            |:..||..||.|.::|.....|..|.|.|:||||:.|..|.|.|.||.:..|| |::|
  Fly   423 HTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLH 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
zf-H2C2_2 281..304 CDD:290200 12/30 (40%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
zf-H2C2_2 339..361 CDD:290200 11/22 (50%)
C2H2 Zn finger 352..372 CDD:275368 9/21 (43%)
zf-H2C2_2 364..389 CDD:290200 4/11 (36%)
C2H2 Zn finger 380..396 CDD:275368
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/107 (37%)
C2H2 Zn finger 368..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 403..423 CDD:275368 5/20 (25%)
C2H2 Zn finger 431..451 CDD:275368 7/20 (35%)
zf-H2C2_2 443..468 CDD:316026 12/25 (48%)
C2H2 Zn finger 459..480 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1784
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.