DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14655 and CG18262

DIOPT Version :10

Sequence 1:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:373 Identity:90/373 - (24%)
Similarity:135/373 - (36%) Gaps:115/373 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 CDICEFSFRNTELRDMHVRLVHENAEG-----EPKQKEPQQKEPDQEPYKCH--LCSKTFRMKGS 171
            ||.|:.::........|.||.|..|.|     ...::..::::...:.|||:  .|::|||.:..
  Fly   174 CDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERD 238

  Fly   172 LRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTA 236
            ||.|                                         |.:||               
  Fly   239 LRGH-----------------------------------------RWKHT--------------- 247

  Fly   237 SQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICAR 301
                   |..                     ||:|.|.||....:.:|::.|:|..|:.|..|..
  Fly   248 -------GIF---------------------CDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDA 284

  Fly   302 TFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFL 366
            ||..|:....|.:.|:...|.:|.||||..::...|..|.|.|:||:|.|||||||.|.......
  Fly   285 TFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLN 349

  Fly   367 VHTRIHTGVMPYKCELCQKTFRYKVSQRTHR-------------CPTEEAQTPEQLIKAFLEGND 418
            ||...||.:.|:.|::|..||:.|.:.|.|:             |....||:..  :.|.:..:|
  Fly   350 VHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGG--LNAHMRSHD 412

  Fly   419 -----SHTQPSPASAEIAAINSSSIVDPEQEALLSQSIDDIVVEQCQK 461
                 ...:|.|.|..|..|...|    .....::.:||..|.||..|
  Fly   413 PARVKGAVKPLPQSVTIEVIEGKS----PPTTTITMAIDLNVEEQLVK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 SUF4-like <157..>180 CDD:411020 10/24 (42%)
C2H2 Zn finger 159..180 CDD:411020 8/22 (36%)
SFP1 <264..345 CDD:227516 26/80 (33%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 340..361 CDD:463886 14/20 (70%)
C2H2 Zn finger 352..372 CDD:275368 9/19 (47%)
zf-H2C2_2 368..389 CDD:463886 8/20 (40%)
C2H2 Zn finger 380..396 CDD:275368 6/15 (40%)
CG18262NP_572453.1 COG5236 <222..>313 CDD:227561 36/174 (21%)
C2H2 Zn finger 224..246 CDD:275368 9/62 (15%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
zf-H2C2_2 263..288 CDD:463886 8/24 (33%)
C2H2 Zn finger 279..327 CDD:275368 16/47 (34%)
zf-H2C2_2 320..342 CDD:463886 14/21 (67%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:395048 4/23 (17%)
C2H2 Zn finger 391..411 CDD:275368 4/21 (19%)

Return to query results.
Submit another query.