DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14655 and Zfp362

Sequence 1:NP_649494.1 Gene:CG14655 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001074567.1 Gene:Zfp362 MGIID:2652839 Length:418 Species:Mus musculus

Alignment Length:390 Identity:100/391 (26%)
Similarity:144/391 (37%) Gaps:105/391 (27%)


  Fly    78 SRGFLAAAPPKRRAKRTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELRDMHVRLVHENAEGEP 142
            ||...:...|.|.|:...:.|....|||   |.|:..|                .||..|     
Mouse     2 SRSSPSGKGPSRMAEPRFNNPYFWPPPP---TMPSQLD----------------NLVLIN----- 42

  Fly   143 KQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIH----------LKVVHMMGVPCSNPNPNPNPS- 196
            |.||....|..:.|   ||...:...:..|.:.          :.:..:..||..:|...|.|. 
Mouse    43 KIKEQLMAEKIRPP---HLPPTSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQSVPQPDV 104

  Fly   197 ---PTPASTTSAVTA------TPKLSICDRIRHTEPGALGNGNNSTCT----------ASQPYAL 242
               ..||  ||.||.      ||.:|..:    :.||. |.|.::..|          ||.|..:
Mouse   105 ALHARPA--TSTVTGLGLSSRTPAVSTSE----STPGT-GTGTSTPSTPTTTSQSRLIASSPTLI 162

  Fly   243 SGALS---------------------------MLQQSPSSP----------ESGTATP--KLWEC 268
            ||..|                           :..::|..|          .||....  |.:.|
Mouse   163 SGITSPPLLDSIKTIQGHGLLGPPKSERGRKKIKAENPGGPPVLVVPYPILASGETAKEGKTYRC 227

  Fly   269 DVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKE 333
            .||..:|.||..::.|.:.||...|:.|..|:::|.......:||..|..|||:.|..|.::|::
Mouse   228 KVCPLTFFTKSEMQIHSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQ 292

  Fly   334 LSTLHNHQRIHSGEKPFKC--EVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFRYKVSQRTH 396
            ||.|..|.|||:|::|:||  ..|.|.|.|..:...|.|.|....||||..|.:.:....|.:.|
Mouse   293 LSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIH 357

  Fly   397  396
            Mouse   358  357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
zf-H2C2_2 281..304 CDD:290200 7/23 (30%)
C2H2 Zn finger 324..344 CDD:275368 9/20 (45%)
zf-H2C2_2 339..361 CDD:290200 11/24 (46%)
C2H2 Zn finger 352..372 CDD:275368 7/22 (32%)
zf-H2C2_2 364..389 CDD:290200 8/25 (32%)
C2H2 Zn finger 380..396 CDD:275368 3/16 (19%)
Zfp362NP_001074567.1 PRK14971 <27..>131 CDD:237874 31/133 (23%)
C2H2 Zn finger 227..247 CDD:275368 7/20 (35%)
zf-H2C2_2 239..264 CDD:338759 7/25 (28%)
zf-C2H2 253..275 CDD:333835 5/22 (23%)
C2H2 Zn finger 255..275 CDD:275368 5/20 (25%)
zf-H2C2_2 267..292 CDD:338759 9/25 (36%)
C2H2 Zn finger 283..303 CDD:275368 9/20 (45%)
SFP1 <305..357 CDD:227516 17/52 (33%)
C2H2 Zn finger 311..333 CDD:275368 7/22 (32%)
C2H2 Zn finger 341..361 CDD:275368 4/18 (22%)
C2H2 Zn finger 373..391 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.