DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and ece1

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001071260.1 Gene:ece1 ZFINID:ZDB-GENE-061110-100 Length:752 Species:Danio rerio

Alignment Length:719 Identity:140/720 (19%)
Similarity:242/720 (34%) Gaps:234/720 (33%)


  Fly    39 LDTSKQPCQDFYGYVC----------------SHSANLSETGRQRFQSLLKETDVAQLMDMELQL 87
            ||.|..||||||.:.|                ...:||.|......::||:.|.:..|...|.:.
Zfish    97 LDRSVDPCQDFYNFACGGWMRKNPLPEGKSRWGPFSNLWEHNMAVMKNLLENTSMKSLSRAEQKA 161

  Fly    88 INFFKSCESGRGVEALKG---SQLYRQSGGWPSLEP----------NKVNASQRTNQTQRWLGLL 139
            ..::::|.:...:|.|..   ..|..|:|||....|          ..|:|:.||          
Zfish   162 QWYYQACMNESKIEELGAKPLQDLINQTGGWGLKGPWEKDNFQEVLRIVSANFRT---------- 216

  Fly   140 GYFHEVGAPYF--FETSVTMQSNKRLVVLQPDG----TRRNTLRK------------FEQRVGEV 186
                   :|:|  |.::.:..||..::.:...|    :|...|.|            |...:|.:
Zfish   217 -------SPFFTVFVSTDSKSSNSNIIQVDQSGLGLPSREYYLNKTANEKYLNAYLNFLVELGVL 274

  Fly   187 L------------QSFGIEQSRAHVTALEVLSLERSRRDIVKADHVEDQVQFSYGNFKRIVFGNA 239
            |            :....|.:.|::|..:|     .|||       |:::.:.....:......|
Zfish   275 LGGSQDTSQKMMEEIIEFETTLANITVPQV-----ERRD-------EEKIYYKIQAKELATLAPA 327

  Fly   240 SLIRLDWDGYFRKLLGGKTPQASDTIVVKQLPRLVEYFALLQNTSMVRLLNWIWTDYLMDIV--- 301
                :||..:...:........|:.:||.....|.:...|:.||:...|.|::    :|.:|   
Zfish   328 ----IDWMPFLSSVFAPVELNNSEPVVVYAKEYLQKVSELISNTNKSVLNNYM----IMKVVRKM 384

  Fly   302 ---------DAD--------------------CHQLSETYAGDLYAHVVQRVT---ANRVELAQM 334
                     ||:                    |...:::..|.....:..:.|   .::..:..|
Zfish   385 VSILDQKFQDAEQRFLEVMYGTKKSCMPRWKLCVSDTDSALGFALGALFVKATFSEDSKAFVEDM 449

  Fly   335 YSELGKAYTDQLGGSVWIDEISRQSSRQFLGNIMHTTLNGDERLDAAYHSILLGRRSLYRNLEKL 399
            .||:..|:.|.|....|:|..::::::              |:.||.|:  ::|......|.::|
Zfish   450 VSEIKWAFEDSLKTVSWMDPETKKAAK--------------EKADAIYN--MVGYPKFIMNPKEL 498

  Fly   400 RK------------FQRTRRLASHSAQ----QVRRYA-----QMFAP-VNAFLG----------- 431
            .|            ||......:.||:    |:|:..     .|..| |||:..           
Zfish   499 DKVFNDFDVVSDLYFQNVMNYYNFSARVTADQLRKAPNRDQWSMTPPTVNAYYNPTKNEMVLPAG 563

  Fly   432 -------QHNLSTPLNY----LLLGEFFSRSLVAAGSSSRTQG---AWRSSDSERRFAIFQQCVG 482
                   .|.....:|:    :::|...:.:....|......|   .|..:.|...|....||:.
Zfish   564 IFQAPFYNHAWPKAMNFGGIGVVMGHELTHAFDDQGRKYDKDGNLAKWWQNSSVEAFQHQTQCMV 628

  Fly   483 KQ----------TNAIDLLLSLLAQRQALS----AYGQWL---ATQAGLVERVDAVLAAGSSKMS 530
            :|          .|....|...:|....|:    ||..|:   ..:|.|.       |.|   |:
Zfish   629 EQYSNYSINNEPLNGKHTLGENIADNGGLNAAYKAYVNWIKKNGEEASLP-------ALG---MN 683

  Fly   531 LQRLFFVTSLLVDC------RSELGAL----QQDRKRQVTHATLRNSPEFLEAFRCRPGDVLYPQ 585
            ..:||||....|.|      .|..|.:    ...|.|.:  .|:.||.||.|.|.|:....:.|:
Zfish   684 NHQLFFVGFAQVWCSVRTPESSHEGVITDPHSPSRFRVI--GTISNSHEFSEHFGCKADSPMNPK 746

  Fly   586 DQRC 589
             ::|
Zfish   747 -RKC 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 136/712 (19%)
ece1NP_001071260.1 PepO 94..752 CDD:226118 140/720 (19%)
M13 101..750 CDD:189000 137/716 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.