DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and Nepl17

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_651641.1 Gene:Nepl17 FlyBaseID:FBgn0039609 Length:681 Species:Drosophila melanogaster

Alignment Length:715 Identity:152/716 (21%)
Similarity:266/716 (37%) Gaps:179/716 (25%)


  Fly     2 ISKALAVLWIAGIAY-------GQDDLLRV--ETELLSFSHNLEPYLDTSKQPCQDFYGYVCSHS 57
            ::.|:..|.|.|..:       || .::|:  ..|:.||       :|||..||.|||||.|.:.
  Fly    13 VTLAVGSLAIQGGVFKELTTPLGQ-QIMRIAKSAEMCSF-------MDTSVSPCDDFYGYACGNY 69

  Fly    58 ANLSETGRQRFQSLLKETDVAQLM---------------------DMELQLINFFKSCESGRGVE 101
            |.::....|      |:|::.|||                     .||:::..|::||.....:.
  Fly    70 ATINAATSQ------KDTNIRQLMFANYLRRVRQVLNEPRISTDRPMEVRVKYFYESCLDTAALR 128

  Fly   102 ALKGSQL---YRQSGGWPSLEPNK-----VNASQRTNQTQRWLGLLGYFHEVGAPYFFETSV-TM 157
            ..:.|.|   .|:.||.|::|...     .:|.:...|..|..|.|........|..|.:.: .:
  Fly   129 TKQRSHLLSVLREFGGMPAVEGKSWDYVGFDAIEMMAQLLRRYGKLTLLGVYVVPDHFNSQIKRL 193

  Fly   158 QSNKRLVVLQPDGTRRNTLRKF--EQRVGEVLQSFGIEQSRAHVTALEVLSLE----------RS 210
            |..:||.:.:.| ...:..:|:  :.|:..:|   |:.:..|..||.|::.||          |.
  Fly   194 QLGQRLDLAESD-EFASLWKKYALKMRLRNLL---GLSEELARKTAEEIIELELELSRSAFDHRM 254

  Fly   211 RRDIVKADHVE--DQVQFSYG---NFKRIVFGNASLIRLDWDGYFRKLLGGKTPQASDTIVVKQL 270
            .||.....|:.  ..:..:||   |..|.|        ..|       ||.:    .:..|.:.:
  Fly   255 NRDPRLMRHLTMLSNMSDAYGPILNVTRFV--------TSW-------LGSE----YNLPVFESV 300

  Fly   271 PR-LVEYFALLQNTSMVRLLNWIWTDYLMDI-VDAD-------CHQLSETYAGDLYAHVVQR--- 323
            |. |.:...:|.:|....:.|::.:..|.|. :.|:       ||:.......|:..|:|..   
  Fly   301 PSYLFQVKKILLSTPNHVVANYMLSSLLTDFEITANEEQQKVICHERITELFPDVVDHMVYHSLE 365

  Fly   324 ----VTANRVELAQMYSELGKAYTDQLGGS--VWIDEISRQSSRQFLGNIMHTTLNGDE-RLDAA 381
                ..||  |:..::.||..::.:.|...  .|:::.:|:...:.|..:......|.. ..:..
  Fly   366 QQNPYIAN--EMRSLWVELKSSFREMLSSPDIEWLEKQTREELLEKLNGMSFEIAGGQAVNFEEQ 428

  Fly   382 YHSILLGRRSLYRNLEKL----RKFQRTRRLASHSAQQVRRYAQMFA-------------PV--- 426
            :..:::.....|.|:::|    .:..||..|...|:  |..|..:.|             ||   
  Fly   429 FGDLVVSSADYYGNIQRLLEVKARILRTDLLRESSS--VYYYHGVTATPIYETETNLVVLPVSYM 491

  Fly   427 -NAFLGQHNLSTPLNYLLLGEFFSRSLVAAG---------SSSRTQGAWRSSDSERRFAIFQQCV 481
             :.:|........|.|..|| |.....:|.|         |.......| |:.::..|.:.:.|:
  Fly   492 QHRYLWDDIYPAALKYGTLG-FTMAHEMAHGFDDLNRLYDSRGNLNDNW-STQTKVGFELVKNCL 554

  Fly   482 GKQTNAI---DLLLSLLAQ-----------RQALSAYGQWLATQAGLVERVDAVLAAGSSKM--S 530
            ..|.:.:   :|.|..|..           |.|.|||.:||       ::|:.........|  |
  Fly   555 ADQFSGMLYGNLRLRRLKSQAESIADNVGIRIAQSAYWKWL-------DQVEMEETESLPHMTQS 612

  Fly   531 LQRLFFVTSLLVDCRSELGALQQDRKRQVTH--------ATLRNSPEFLEAFRCRPGDVLYPQDQ 587
            .::|||:::....|.......:.:..|...|        |.:.|||.|.|||:|.....:.|.::
  Fly   613 PEQLFFLSAAQFMCSDIYPERRANFVRNNFHPPYEARVFAMMINSPAFAEAFQCSNSSKMNPPNK 677

  Fly   588  587
              Fly   678  677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 139/664 (21%)
Nepl17NP_651641.1 PepO 49..672 CDD:226118 143/672 (21%)
M13 55..678 CDD:189000 139/666 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.