DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and Nep7

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_651603.1 Gene:Nep7 FlyBaseID:FBgn0039564 Length:717 Species:Drosophila melanogaster

Alignment Length:753 Identity:145/754 (19%)
Similarity:253/754 (34%) Gaps:270/754 (36%)


  Fly    20 DLLRVETELLSFSHN--LEPYLDTSKQPCQDFYGYVCSHSANLSETGRQR--------------- 67
            |.||        ||.  ::.|::.|..||.|||.:.|.:..|: :|.||.               
  Fly    49 DYLR--------SHGAMMKSYMNFSVDPCDDFYEFACGNWKNV-KTPRQSPHRRSNILDISYTLM 104

  Fly    68 --FQSLLKETDVAQLMDMELQLI---NFFKSCESGRGVEALKGSQLY----RQSGGWPSLEPNKV 123
              .:.||..|.:|:.:::..:|:   .|:.||.:............|    |..||:|:::.:..
  Fly   105 DVTEQLLTRTKLAEALNVSAELLVAQRFYNSCLAAELFPRPAADPAYLSVIRSLGGFPAVDRDAW 169

  Fly   124 NASQRTNQTQRWLGLLGYFHEVGA---------------PYF----------FETSVTMQSNKRL 163
            |||..:     |..:..:....|.               |||          ..|:....::.|.
  Fly   170 NASSFS-----WFNMSAHLSNYGVRSLIHEEILPQHPFNPYFKLPELGFDHVVHTAHVANTSSRA 229

  Fly   164 VVLQPDGTRRNTLRKFEQRVGEVLQSFGIEQSRAHVTAL---------EVLSLE---RSRRDIVK 216
            ..|.            |.|:...|:.:.:  ::..::|:         |.||:|   .|.||  |
  Fly   230 YQLN------------EHRMRGYLKEYNL--TKDEISAVIEGVFAFWSEALSIEDKFESDRD--K 278

  Fly   217 AD---HVEDQVQFSYGNFKRIVFGNASLIRLDWDG--YFRKLLGGKTPQ----ASDTIVVKQLPR 272
            .|   .:|:..:|  |.::       |...:.|:|  ::....||:...    ..|.:..|....
  Fly   279 CDLLSEIEEVPRF--GQWR-------SYYEIAWNGIDFYNGSSGGEFCDFYYVELDKVCAKHTEA 334

  Fly   273 LVEYFALLQNTSMVRLLNWIWTDYLMDIVD------------ADCHQLSETYAGDLY--AHVVQR 323
            :..|.|:       |.|      |.||  |            .:|..:.:....:|:  .::.:.
  Fly   335 VANYLAM-------RFL------YRMD--DKLKEPKQPEDQKVNCLMIVQMTLPNLFNRLYMAEH 384

  Fly   324 VTANR-VELAQMYSELGKAYTDQLGGSVWIDEISRQSS---------------RQFLGNIMHTTL 372
            .|..: .|::.|.:|:.||....|....|:|..:|..:               .:.|.:.:...:
  Fly   385 FTDEKHSEISDMVTEMRKAQRQILESVEWLDAETRAEALSKEAGITPVIGSYKNEELSDTLIREI 449

  Fly   373 NGDERLDAAYHSILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQMFA------------- 424
            |....::.:|...|:..|.|                    ...:.|||.:.|             
  Fly   450 NNLTIVEGSYAQSLINLRVL--------------------GTYLHRYAGLHADELPKDTKPLTLL 494

  Fly   425 ---PVNAFLGQHNLSTPLNYL------------------------LLGEFFSRSLVAAGSSSRTQ 462
               .||||  .:||...:..:                        |:|...:......|||..:.
  Fly   495 VGMQVNAF--YYNLDNSVYVMAGVLHPPAYHRSWPDSLKFGTIGYLIGHELTHGFDTEGSSFDSA 557

  Fly   463 GAWRSSDSERRFAIFQ---QCV-----------------GKQT---NAID---LLLSL------L 495
            |..|...|.:..|:||   ||.                 |.:|   |..|   |..:|      :
  Fly   558 GEVRDWWSRKSEAVFQERAQCYVDYFNQYLIPEINQTIRGNETRDENIADAGGLRAALTGYRNHM 622

  Fly   496 AQRQALSAYGQWLATQAGLVERVDAVLAAGSSKMSLQRLFFVTSLLVDCR--------SEL-GAL 551
            .|.|...|.|:.||.:...:..:|         :|.::||||....:.|.        .|| ||.
  Fly   623 KQLQRSGADGETLAHKNEQMPGLD---------LSPEQLFFVGFAQLWCADYEPEHYWEELTGAH 678

  Fly   552 QQDRKRQVTHATLRNSPEFLEAFRCRPGDVLYPQDQRC 589
            ..|:.|.:  ..:.|:.:|.|.::|..|..::|:.:.|
  Fly   679 TVDKYRVL--GAVSNNDDFAEVYKCPLGSPMHPKAESC 714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 137/725 (19%)
Nep7NP_651603.1 PepO 60..717 CDD:226118 140/735 (19%)
M13 66..715 CDD:189000 138/729 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.