DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and Nepl16

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001097912.1 Gene:Nepl16 FlyBaseID:FBgn0039277 Length:752 Species:Drosophila melanogaster

Alignment Length:688 Identity:128/689 (19%)
Similarity:231/689 (34%) Gaps:230/689 (33%)


  Fly    34 NLEPYLDTSKQPCQDFYGYVC------SHSANLSETGRQRFQSLLKETDVAQLMDMELQLI---- 88
            :::..|:.:|.||.:|..:.|      .:..||.|.|..:     |..|...|...:.:::    
  Fly   166 SIQARLNWNKDPCTEFKKFSCWRNTPNKNITNLIEMGNSQ-----KSVDSQMLYLFQNKIMNGSF 225

  Fly    89 ----NFFKSCESGRGVEALKGS----QLYRQSGGW---PSLEPNKVNASQRTNQTQRWLGLLGYF 142
                |.|:||     ::....|    :::...||:   .|:.|:.:            ..|:...
  Fly   226 GILHNLFESC-----LQQTTNSTVMHRIFDSLGGYLPVGSVGPSSI------------APLIAKI 273

  Fly   143 HEVGAPYFFETSVTMQSNKR---LVVLQPDGTRRNTLRK-------------------------- 178
            :::|.....:....:...:|   |:::....|....|.:                          
  Fly   274 YDLGPSPLVDLYHDLSYGRRPHILLIISGPSTSSTILERKIRWMSPKAPPSRIRQGVPKLLADLI 338

  Fly   179 ---------FEQRVGEVLQSFGIEQSRAHVTALEVLSLERSRRDIVKADHVEDQVQFSYGNFKRI 234
                     :.|||.|....|      ..:..|..|.:|.|||                |.:...
  Fly   339 ENFLPYFVSYAQRVSEKDTIF------EFIKDLNKLQVEHSRR----------------GFWDST 381

  Fly   235 VFGNASLIR-----LDWDGYFRKLLGGKTPQA-SDTIVVKQLPRL--VEYF-----ALLQNTSMV 286
            |..|.|.::     |:|     .||   .||. |..|||:....|  :|||     ..:.:.|::
  Fly   382 VLYNVSSLQDLYPVLNW-----TLL---IPQNWSGPIVVRNSDYLKALEYFLTKYPTRVAHNSLL 438

  Fly   287 RL--LNWIWTDYLMDIVDADCHQLSETYAGDLYA--HVVQ------RVTANRVELAQMYSELGKA 341
            .|  |..:..||....|   |.:.:.....:|.:  ::.|      :.|..|.|:  ::..| ||
  Fly   439 LLSALQILPRDYPSPEV---CTRSTMWALPELSSSLYIAQHSSEDLKDTTKRAEI--IFKSL-KA 497

  Fly   342 Y---TDQLGGSVWIDEISRQSSRQFLGNIMHTT--LNGDERLDAA----YHSILLGRRSLYRNLE 397
            :   ...|.|:..:...:.:...|......:||  |...:.|:..    :.:||    .:|:. .
  Fly   498 HLKRAPSLKGAALVKLSALKIQSQTWEGFSNTTDLLKSLQPLNITSECWFQNIL----EIYKK-N 557

  Fly   398 KLRKFQRTRRLASHSAQQVRRYAQMF---------APVNAFLGQH-NLSTP--LNYLLLGEFFSR 450
            ||.....:....||.|......:.:|         .|::..|..: |...|  |:|..:|...::
  Fly   558 KLEPNDISLNGGSHDAWAYPIVSTIFYDTLSHSIVVPLSVILIPYFNAVLPPYLHYASVGVSIAK 622

  Fly   451 SLVAAGSSSRTQGAWRSSDSERRFAIFQQCVGKQTN------AIDLLL----SLLAQRQALSAYG 505
            .::.:.:.|..:.|.|             ||....|      .:|:|:    ..::....||..|
  Fly   623 EILRSITKSFDEKAMR-------------CVPHSVNIFSNYSRMDILIHSGGMQISYHSMLSLTG 674

  Fly   506 --QWLATQAGLVERVDAVLAAGSSKMSLQRLFFVTSLLVDCRSELGALQQDRKRQVTHATLRNSP 568
              :.:|...||             .::..::||:.|....| :|...|..|          .|:|
  Fly   675 PIKGMARLPGL-------------NLTPTQIFFLVSAQELC-AESNYLGID----------TNAP 715

  Fly   569 EF--------------LEAFRCRPGDVLYPQDQRCNPL 592
            ||              .|.|:|..|.::..| :.||.|
  Fly   716 EFDNILGWLVAQGGSATEVFKCPSGSMINVQ-KTCNVL 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 123/673 (18%)
Nepl16NP_001097912.1 GluZincin 176..749 CDD:301352 123/674 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.