DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and Nep3

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001245775.1 Gene:Nep3 FlyBaseID:FBgn0031081 Length:786 Species:Drosophila melanogaster

Alignment Length:693 Identity:132/694 (19%)
Similarity:242/694 (35%) Gaps:173/694 (25%)


  Fly    39 LDTSKQPCQDFYGYVCSH--SANLSETGRQRFQSLLKETDVAQLM--------------DMELQL 87
            :|.:..||.|||||.|:.  ..|....|:..:.:..|...:.||:              |.|.:.
  Fly   119 IDVTVDPCDDFYGYSCNQWIKNNPIPEGKSTWGTFGKLEQMNQLIIRNVLEKPAKSFKSDAERKA 183

  Fly    88 INFFKSC-ESGRGVEALKG---SQLYRQSGGWPSLEPNKVNASQRTNQTQRW-----LGLLGYFH 143
            ..:::|| ::...:|.|..   :.|..|.|||        |.::.......|     |.:|...:
  Fly   184 KVYYESCLDADEHMEKLGAKPMNDLLLQIGGW--------NVTKSGYNVANWTMGHTLKILHNKY 240

  Fly   144 EVGAPYFFETSVTMQSNKRLVVLQPDG---------------TRRNTLRKFEQRVGEVLQSFGIE 193
            .....:.:......:::.|.|:....|               ..|..|.::.:.:.:|....|..
  Fly   241 NFNCLFGWAIGEDDKNSSRHVIQIDQGGLTLPTADYYNNKTDNHRKVLNEYIEYMTKVCVLLGAN 305

  Fly   194 QSRAHVTALEVLSLERSRRDIV--KADHVEDQVQFSYGNFKRIVFGNASLIR-LDWDGYF---RK 252
            :|.|....:.|::.|:...:|.  ..|...::..:.....:::    :.|.. |:|..:|   .:
  Fly   306 ESDARAQMIGVINFEKKLANITIPLEDRRNEEAMYHPMQLRQL----SKLAPFLNWTDHFDNAMQ 366

  Fly   253 LLGGKTPQASDTIVVKQLP----RLVEYFALLQNT--SMVRLLNWIWTDYLMDIVDADCHQLSET 311
            ::|.:.  ..|.:||...|    .|.:....::.|  ..:.|.|::....:..:.........:.
  Fly   367 MVGRRV--TDDEVVVVYAPDFLKNLSDIILKMEQTEEGKITLNNYLVWQAVRTLTSCLSKPFRDA 429

  Fly   312 YAG------------DLYAHVVQRVTANRVELA-------------------QMYSELGKAYTDQ 345
            |.|            :::.:.|.. |.|.|..|                   ||.:|:.:|:...
  Fly   430 YKGVRKALMGSDGGEEIWRYCVSD-TNNVVGFAVGAIFVRQAFHGESKPAAEQMIAEIREAFKMN 493

  Fly   346 LGGSVWIDEISRQSSRQFLGNIMHTTLNGDERLDAAYHSILLGRRSLYRNLEKLRKFQRTRRLAS 410
            |....|:|:.:|:.:.:....|.......|..||    .:.|.::....|:.....|:...::|.
  Fly   494 LQNLTWVDKQTREKAIEKANQISDMIGFPDYILD----PVELDKKYAELNITPNAYFENNIQVAI 554

  Fly   411 HSA--------QQVRRYAQMFAP--VNAFLGQHN---------LSTP---------LNYLLLGEF 447
            ::.        |.|.:......|  |||:.....         |.||         ||:..:|..
  Fly   555 YNLKSNLKRLDQPVNKTNWGMTPQTVNAYYTPTKNQIVFPAGILQTPFFDINNPKSLNFGAMGVV 619

  Fly   448 FSRSLVAA-----------GSSSRTQGAWRSSDSERRFAIFQQCVGKQTNAIDLLLSLLAQRQAL 501
            ....|..|           |:.:|    |..|.|..||....:|:.:|.:...:....|..:|.|
  Fly   620 MGHELTHAFDDQGREYDKFGNINR----WWDSKSIERFNEKSECIARQYSGYKMNGRTLNGKQTL 680

  Fly   502 SAYGQWLATQAGLVERVDA-----------VLAAGSSKMSLQRLFFVTSLLVDCRS---ELGALQ 552
               |:.:|...||.....|           :|......::..:||||:...|.|.|   |...||
  Fly   681 ---GENIADNGGLKAAYHAYQRTKSDRDVDILKLPGLNLTHSQLFFVSFAQVWCSSTTDETNLLQ 742

  Fly   553 QDRKRQVTHA--------TLRNSPEFLEAFRCRPGDVLYPQDQ 587
            .::.   .|:        ||.|..||.|.|:|:||..:.|.::
  Fly   743 MEKD---PHSPSQFRVIGTLSNMKEFAEVFQCKPGKRMNPTEK 782

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 131/688 (19%)
Nep3NP_001245775.1 M13 123..784 CDD:189000 131/690 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.