DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and Nepl3

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_608904.1 Gene:Nepl3 FlyBaseID:FBgn0031678 Length:629 Species:Drosophila melanogaster

Alignment Length:695 Identity:139/696 (20%)
Similarity:232/696 (33%) Gaps:198/696 (28%)


  Fly     6 LAVLWIAGIAYGQDDLLRVETELLSFSHNLE------PYLDTSKQPCQDFYGYVCSHSANLS--- 61
            |::.|:         ||.:.:.:.|.:.|||      ..:|...:||.:||.   |...||.   
  Fly     8 LSLSWL---------LLLLCSTVCSANPNLEIMKRMLDDMDEKVEPCHNFYN---SSQKNLKWHA 60

  Fly    62 -ETGRQRFQSLLK--ETDVAQLMDMELQLINFFKSCESGRGVEALKGSQLYR--QSGGWPSLEPN 121
             .|...:||.|..  |.:|.:....|.:|...:|.|.:......|:..:|.:  :...||.|.| 
  Fly    61 FATVSDQFQLLFDGIENEVFEKHSFEEKLQRLYKICSTMERPSLLRYFELVKPGEDLNWPFLTP- 124

  Fly   122 KVNASQRTNQTQRWLGLLGYFHEVG-APYFFETSVTMQSN----KRLVVLQPDGTRRNTLRKFEQ 181
              ...:...:..:|:..|......| ....|..|:....|    :.:||.:         :|::.
  Fly   125 --RGGKWPKEKFQWMEALARLRRYGFNDIMFGMSIRQDPNSDSGQPIVVFE---------KKYDS 178

  Fly   182 --RVGEVLQSFGIEQSRAHVTALEVLSLERSRRDIVKADHVEDQVQFSYGNFKRIVFGNASLIRL 244
              |..|.||:.|:...    .|.|:..|:.:.:::.|:|...:.........|||..|...:..:
  Fly   179 LFRFIESLQNIGLPPK----LAKEIAPLDNAIQEMYKSDMKFEHYARDAAPVKRISLGQLEIYGV 239

  Fly   245 DWDGYFRKLLGGKTPQASDTIV-VKQLPRLVEYFALLQN-----TSMVRLLNWI---WTDYLM-- 298
            ....|...:.|  .|.:.|.:| |:.|    .|...|||     .|.| :.|::   ::.|:|  
  Fly   240 SLTKYLEIVFG--RPFSPDFVVHVENL----YYLRGLQNLMTAVPSQV-VANYLTARFSFYIMFT 297

  Fly   299 -----DIVDADCHQLSETYAGDLYAHVVQRVTANRVELAQMYSELGKAYTDQLGGSVWIDEISRQ 358
                 |.......|..| :|.:|   :.:.....|.:|....::.||.:          |.|.:|
  Fly   298 FMKHGDSCVTTMRQSME-FASNL---LFEERILGRKKLRSYQNQAGKIF----------DAIRQQ 348

  Fly   359 SSRQFLGNI----------MHTTLNG-----------------------------DERLDAAYHS 384
            .:.:...|:          :...|||                             ||.|..|:..
  Fly   349 LNIRLERNVLKLPPAEISLLQKKLNGLSLSIGNLPGKAGHRRFVTRYYKELEFADDEELATAHLK 413

  Fly   385 ILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQMFAPVNAFLGQHNLSTPLNYLLLGEFFS 449
            :|..|.....:|.....| :.||...||           .|::.|..:.......|.:.:...| 
  Fly   414 VLEHRTRAELSLLDQPNF-KDRRYMLHS-----------YPISNFFFETAYEENGNTIYVAYDF- 465

  Fly   450 RSLVAAGSSSRTQGAWRSSDSERRFAI-------FQQCVGKQTNAIDLL------------LSLL 495
              |..|.....:...::.:....||.:       ...|...:.|.:.|.            :|..
  Fly   466 --LADASFDPDSHDIFKVTPLGIRFGLEMLKSFDLFNCKHHKVNMLQLFDDNQITTAGDECVSAW 528

  Fly   496 AQRQALSAYGQWLATQAGLVERVDAVLAAGS---------SKMSLQRLFFVT------------- 538
            .|...||...|:|.. ..||.  :|..|.||         :.|||:.|||..             
  Fly   529 TQDNLLSQRDQYLVV-LHLVH--EAYFAEGSKFSQRQPNFTTMSLRELFFFRFGQSSFGQTLYFG 590

  Fly   539 SLLVDCRSELGALQQDRKRQVTHATLRNSPEFLEAFRC-RPGDVL 582
            |..|:..|.:.:|.:             .|.|:..|.| .||:.|
  Fly   591 SDFVEGGSPINSLTR-------------LPVFVRTFNCLAPGEQL 622

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 130/651 (20%)
Nepl3NP_608904.1 GluZincin 42..581 CDD:301352 119/597 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.