DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and frma

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_572226.2 Gene:frma FlyBaseID:FBgn0029769 Length:611 Species:Drosophila melanogaster

Alignment Length:705 Identity:149/706 (21%)
Similarity:227/706 (32%) Gaps:239/706 (34%)


  Fly    21 LLRVETELLSFSHNLEPYLDTSKQPCQDFYGYVC-----SHSANLSETGRQRFQSLLKETDVAQL 80
            ||.:...||.......|..|    |||:||...|     ||:.:..|:...|.....:| .:|.|
  Fly     7 LLELIVGLLVVQVKSHPQAD----PCQNFYKVACGNWSASHATDSYESFMDRLDYNYQE-KLADL 66

  Fly    81 MDME---------LQLINFFKSCESGRGVEALKGSQLYRQSGGWPSLEPNKVNASQRTNQTQRWL 136
            :|.|         .||.||:.:|.     :.|...|:.|      .||...|..:.:..:.    
  Fly    67 LDNEREDDEPHFLQQLRNFYTACR-----KPLSQDQVLR------ILEHLIVMENIQNEEL---- 116

  Fly   137 GLLGYFHEVGAPYFFETSVTMQSN--------KRLVV----LQPDGTRRNTLRK----------- 178
                   .||....|...|.:..|        |:|:.    ..|:.|.|..|.:           
  Fly   117 -------SVGLTAAFRLQVLIDLNDSNTYDIWKQLMSHRKHWDPNTTNREPLTREMFDKLWASLP 174

  Fly   179 -----FEQ-------RVGEVLQSFGIEQS--------------------RAHVTALEVLSLERSR 211
                 |::       .:.|.:.|:|.|..                    ..::| .|.||.....
  Fly   175 KIPFPFKEYYWRELSELEEKIMSYGSEDDGFDSGDLVTRIPPFWMMPWPNGNIT-YENLSQMAHW 238

  Fly   212 RDIVKADHVEDQVQFSYGNFKRIVFG-NASLIRLDWD---GYFRKLLGGKTPQASDTIVVKQLPR 272
            .|| ||:  |..:.:.|...|.:..| :.....:|.|   ...|::|  ..|.|  .:|.|..||
  Fly   239 LDI-KAN--EFILTYIYMRLKLVAEGVSTESWHIDRDQCAEQSRQIL--SHPAA--WLVEKNHPR 296

  Fly   273 LVEYFALLQNTSMVRLLNWIWTDYLMDIVDADCHQLSETYAGDLYAHVVQR----VTANRVELAQ 333
            |.|                                  |....|::|.:.||    :.|||....:
  Fly   297 LKE----------------------------------EPVLQDIFAELKQRFGQKLLANRNNFTR 327

  Fly   334 --MYSELGKAYTDQLGGSVWIDEISRQSSRQ-------------------FLGNIMHTTLN--GD 375
              .:..|||....:|..|:    :.|.||.|                   :.|| :|..||  ..
  Fly   328 STQHFLLGKLKRMRLRLSI----LPRNSSAQSMVRRIERHYRDVHMNASDYFGN-LHIGLNHSRS 387

  Fly   376 ERLDAAYHSILLGRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQMFAPVNAFLGQHNLSTPLN 440
            .:..|...:|:.||:.:...:.|...:          ..|||.|. .:|.....:.|:.|..||:
  Fly   388 HKKYAQLWAIVFGRQLIPSRISKSDLY----------PTQVRGYG-TYASAFYIVKQNMLIVPLS 441

  Fly   441 YL--------------------LLGEFFSRSLVAAGSSSRTQGAWRSS-DSE-RRFAIFQQCVGK 483
            .|                    :||...|....:.|.:..:.|...|: |.| .|...|||.:| 
  Fly   442 LLEPPFYTHGQPSILTYSALGFILGHELSHGFDSEGMTFSSHGVGSSAVDRELDRNPRFQQELG- 505

  Fly   484 QTNAIDLLLSLLAQRQALSAYGQWLATQAGL---------VERVDAVLAAGSSKMSLQRLFFVTS 539
                      .|.:|.....|.:: |..:||         ..:.|......:.::..|:..|..:
  Fly   506 ----------CLRRRFGRKRYEKF-ADASGLELAYSAYFDTAQTDHKRNRSAEELVTQKQQFFHN 559

  Fly   540 LLVDCRSELGALQ-----QDRKRQVTHATLRNSPEFLEAFRCRPGDVLYPQDQRC 589
            ......|:...||     .|||| |..|.....| |.|||.|.|.    |:.::|
  Fly   560 FAQFFCSDKELLQAHDHGSDRKR-VNDAVAHFEP-FREAFSCGPS----PRRRQC 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 142/680 (21%)
frmaNP_572226.2 GluZincin 25..601 CDD:301352 141/675 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11733
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.