DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and nep-6

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_494537.1 Gene:nep-6 WormBaseID:WBGene00017550 Length:726 Species:Caenorhabditis elegans

Alignment Length:695 Identity:140/696 (20%)
Similarity:256/696 (37%) Gaps:197/696 (28%)


  Fly    27 ELLSFSHNLEPYLDTSKQPCQDFYGYVCSHSANLSETGRQRFQS------------LLK-ETDVA 78
            :||:|.       |.|..||||||...|...:. .|...:|.|.            ||| ||..:
 Worm    96 QLLNFQ-------DPSVDPCQDFYKAACGKYSE-HEVANRRLQKKDIIIQRMIKNFLLKNETSES 152

  Fly    79 QLMDMELQLINFFKSCESGRGVEALKGS------QLYR---QSGGWPSLEPN----KVNASQRTN 130
            :..::..|:   :::||..:..|....:      :|::   :.|.||:.:.|    |:|.::   
 Worm   153 KSENVMRQV---YRTCEGLKNEEIFNANMKTAFRELFKDIQKIGSWPAADKNWDETKLNLNE--- 211

  Fly   131 QTQRWLGLLGYFHEVGAPYF--FETSVTMQSNKRLVVLQPDGTRR-NTLRKFEQRVGEVLQSFGI 192
                   :|....::|:..|  |:...|   ....:.:.||..|. .....|:|.:.::|:..|:
 Worm   212 -------MLLNIVKLGSSNFGLFQIRPT---EVPFLEVAPDMARSPKVSANFQQIIFDILEKNGL 266

  Fly   193 EQSRAHVTALEVLSLERSRRDIVKADHVEDQV-------QFSYG-NFKRIVFG--NASLIRLDWD 247
            :..                 :.|.||.|||.:       |::|. |.:::.|.  .|.:..|..:
 Worm   267 QPD-----------------ENVIADDVEDYITLEETLSQYAYDYNAEKVQFSKLQAQVPSLKLE 314

  Fly   248 GYFRKLLGGKTPQASDTIVVKQLPRLVE-----YF-------ALLQNTSMVRLLNWI---WTDYL 297
            ....:::   .|.....:|.|..||:|.     :|       .||::|....|.|::   :.|:.
 Worm   315 KIIEEMM---NPNRKKLLVTKVKPRMVAHKHSLFFDEKMNLEKLLKSTPKRTLANYLIFYYMDHA 376

  Fly   298 MD--------IVDADCHQLSETYAGDLYAHVVQRVTANRVE------LAQMYSELGKAYTDQLGG 348
            |:        |...:|.:|...|.......|..|   |..|      :.:|..|..|::.:.|..
 Worm   377 MNGLSVHDNVIKKRNCEKLVIEYLPKASLRVFVR---NHFEKGNLKIVDEMAEETKKSFIEMLQE 438

  Fly   349 SVWIDEISRQSS---RQFLGNIMHTTLNGDER--LDAAYHSI-LLGRRSLYRNLEKLRKFQRTRR 407
            |.|:...|::::   .:.:|.::......:::  ||..:.:: ||.:.:||..|:|:.:|     
 Worm   439 STWLGADSKKNAILKLEKMGKMIGYPKEFEKKGALDKMFETLKLLPKDTLYGILKKIGRF----- 498

  Fly   408 LASHSAQQVRRYAQMFAPV---------NAFLGQHN--------LSTPL---------NYLLLGE 446
               |..|.: .:..:..|:         |||....|        :..||         |..|.|.
 Worm   499 ---HMEQGI-EFVALETPMDPVLPVLMTNAFYTDRNHLSFLVGYMDDPLFDATYPKYVNIALTGN 559

  Fly   447 FF----SRSLVAAGSSSRTQG---AWRSSDSERRFAIFQQCV------------GKQTNAIDLLL 492
            ..    |.....||......|   :|...:..:.:....||:            ||..|....|.
 Worm   560 ILAHETSHGFDTAGIKRDENGEVRSWMKPEDLKEYGKKTQCLVDQYNEYDDPVFGKNLNGTTTLN 624

  Fly   493 SLLAQRQALSAYGQWLATQAGLVERVDA---VLAAGSSKMSLQRLFFVTSLLVDCR-SELGALQQ 553
            .::|....::.  .|     .:.|::|:   ....|....::.:|:|..:.|..|. ....:|.:
 Worm   625 EMVADMIGVTV--AW-----KVFEKLDSSKEQKVIGFENENIDKLYFRAAALDFCSLPPTTSLVE 682

  Fly   554 DRKRQVTHAT--------LRNSPEFLEAFRCRPGDVLYPQDQRCN 590
            :..|  .|.|        ..|.|:|..||.|..|..:.|: .||:
 Worm   683 ELTR--VHPTGNFRVNGIFSNMPQFATAFNCPEGSPMNPK-TRCS 724

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 134/675 (20%)
nep-6NP_494537.1 M13 105..724 CDD:189000 135/678 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.