DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and nep-22

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_509528.1 Gene:nep-22 WormBaseID:WBGene00020788 Length:798 Species:Caenorhabditis elegans

Alignment Length:750 Identity:155/750 (21%)
Similarity:245/750 (33%) Gaps:235/750 (31%)


  Fly    39 LDTSKQPCQDFYGYVCS---HSANLSETGRQR--------------FQSLLKETDVAQLMDMELQ 86
            ||.:..||||||.:.|:   .:.:|.:.||.|              ..:.|.:.||......:.:
 Worm    79 LDDTVDPCQDFYAFTCNKFLQNTDLQKLGRSRLGTYDQAQVDVYSEIVAALSKIDVTSTTTSKTE 143

  Fly    87 LIN--FFKSCESGRGVEALKGSQLYRQ----SGGWPSL-EPNKVNASQRTNQTQRWL--GLLGYF 142
            .|.  .|::|::.....|.|.:.:|.:    .||.|.. ||.|.|...       |:  |.:...
 Worm   144 RITKAAFETCKNNLASPADKTAVVYAEITSLFGGVPFFGEPLKTNVDY-------WMVAGQIEQK 201

  Fly   143 HEVGA-PYFFETSVTMQSNKRLVVLQPDG--------TRRNTLRKFEQRVGEV---LQSFGIEQS 195
            |.||. .|...:|......|..:...|.|        .:...:.:..|||.:|   |.:|. ..:
 Worm   202 HAVGTLTYTIASSDYKDHTKNALYTGPPGLSLARDFYVKPQYIAEVNQRVSDVNDLLTAFA-NAA 265

  Fly   196 RAHV-------TALEVLSLERSRRDIVKADHVED-----QVQFSYGNFKRIVFGNASLIRLDWDG 248
            :.:|       .|.||::.|   ..|..|...:|     |.|::..|   |.....:...::|..
 Worm   266 KKNVGADALLAAAQEVVNFE---VQIAMASWPDDLLRNYQQQYNPYN---IASATTAYRAINWKS 324

  Fly   249 YFRKLLGG---KTPQASDTIVVKQLPRLVEYFALLQ--------------NTSMVRLL------- 289
            |..:|..|   ...||:..|||.:    ..|||.|.              |..:.:||       
 Worm   325 YLGQLFHGVASDADQANYNIVVTE----PSYFAWLNSVFDGKTSNSTVVANYMIAQLLADESDFI 385

  Fly   290 -----------NWIW--------------TDYLM---DIVDADCHQLSETYA--GDLYAHVVQRV 324
                       |:|.              .:|.|   |.:...|..|...|.  |..|.:|..:.
 Worm   386 NPATAKVSSDTNYIHYALRNGRGIKKIGKREYRMADLDGISEGCMDLLTAYMPYGTGYVYVKSKS 450

  Fly   325 TANRV--ELAQMYSELGKAYTDQLGGSVWIDEISR----QSSRQFLGNI-----MHTTLNGDERL 378
            ..|:|  ::....:.:...:...:....|:|..|:    ..|...:.|.     |....|....:
 Worm   451 ERNKVQADVKDQTTLIINNFQGMIDSLNWMDTFSKNRAHNKSDSLVKNFGWPEAMFGDFNDFTTV 515

  Fly   379 DA---AYHSIL----LGRRSLYRNLEKLRKFQRTR---RLASHSAQQVRRYAQMFAPVNAFL--- 430
            ||   .|.||:    ..:..:|.....|:|....|   |:....|.:. .:.|..|.|||:.   
 Worm   516 DAYNQDYASIIDLYTKDKNDIYGIFAVLKKGMEVREFFRIMGEPADRT-NFLQSPAMVNAWYQPE 579

  Fly   431 -------------GQHNLSTPLNYLLLGEFFSRSLVAAGSSSRTQG------------------- 463
                         ..:||:.|..|...|:      ...|....|.|                   
 Worm   580 RNSITFPYAAWNPPYYNLNYPQAYNFAGQ------GGTGGHELTHGYDDEGVQFGFNGELTDCSW 638

  Fly   464 ---AWRSSDSERRFAIFQQCVGKQ-------------------TNAIDLLLSLLAQRQALSAYGQ 506
               .|..::|...|....|||..|                   |...:.:..|..|:.|..:|.|
 Worm   639 NKCGWMDTNSSSGFIDMAQCVVTQFSTQCCPEKTGNIHCANGATTQGENIADLGGQQAAYRSYRQ 703

  Fly   507 WLATQAGLVERVDAVLAAGSSKMSLQRLFFVT----------------SLLVDCRSELGALQQDR 555
            ::||....||. |.:  .|....:..::|::|                .||.:..|.    .|.|
 Worm   704 YVATTRKGVEE-DRL--PGLENYTPNQIFWITYGYSWCMKQSDANLVHQLLTNPHSP----AQCR 761

  Fly   556 KRQVTHATLRNSPEFLEAFRCRPGDVLYPQDQ-RC 589
            ..||    :::.|||.:.|.|..|..:||:.. ||
 Worm   762 TNQV----MQDIPEFGKDFGCVRGSPMYPEPSGRC 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 152/743 (20%)
nep-22NP_509528.1 PepO 76..795 CDD:226118 155/750 (21%)
M13 83..793 CDD:189000 153/746 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.