DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nepl11 and nep-10

Sequence 1:NP_649449.1 Gene:Nepl11 FlyBaseID:FBgn0037230 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_494532.2 Gene:nep-10 WormBaseID:WBGene00017555 Length:711 Species:Caenorhabditis elegans

Alignment Length:736 Identity:142/737 (19%)
Similarity:240/737 (33%) Gaps:281/737 (38%)


  Fly    27 ELLSFSHNLEPYLDTSKQPCQDFYGYVC----SHSA---NLSETGRQRFQSLLKE---TDVAQLM 81
            |.::.:|.|..|.|.|..||||||.:.|    .|||   ....|.|.....|::|   .:.....
 Worm    81 ECITLAHELHNYKDPSVDPCQDFYQHFCGKFYEHSAIGQGRMATKRSTLSKLIREFLLKNKTSTS 145

  Fly    82 DMELQLINFFKSCESGRGVEALKGSQL--------------YRQSGGWPSLEP----NKVNASQR 128
            ..|..:...:..|.     |..|.|.|              .::.|.||.|:.    :|.|.::.
 Worm   146 KSENTMKQVYAKCR-----ELQKISDLNSIPPQALLDIFSDIKKIGAWPVLDKDWDGSKFNLNEM 205

  Fly   129 TNQTQRWLG--LLGYFH--EVGAPYFFETSVTMQSNKRLVVLQPDGTRRNTLRKFEQRVGEVLQS 189
            ..|... ||  .||:||  .:..||              |:::|      .|::           
 Worm   206 LRQLVN-LGETHLGFFHFDFIARPY--------------VLIKP------PLKQ----------- 238

  Fly   190 FGIEQSRAHVTALEVLSLERSRRDIVKADHVEDQVQFSYGNFKRIVFGNASLIRLDWDGYF---R 251
             |:::|          .||:..:.|::|:.::....||.                |.|.||   .
 Worm   239 -GVQKS----------VLEKVVKMILEANEIKMDQGFSE----------------DLDEYFELSN 276

  Fly   252 KLLGGKTPQASDTIV---------------VKQLPR-------------LVEYF----------- 277
            ::...|.|:.|.:||               ::.:||             :|.|.           
 Worm   277 RIKIDKLPRTSRSIVGLLPDVRRINFRGLILEMMPRSKMNRFLGTLFQKVVTYHHPLFVRDNETN 341

  Fly   278 ---ALLQNTSMVRLLNWIWTDYLMDIV---------DAD-CHQLSETYAGDLYAHVVQRV----- 324
               .::::||...|.|::..:::...:         |.: |.::           |||.:     
 Worm   342 HLDTIIRSTSNRALANYLIFNFIHSSIKFLTFGLKSDRERCEKI-----------VVQELPRPSL 395

  Fly   325 ---------TANRVELAQMYSELGKAYTDQLGGSVWIDEISRQSSRQFLGNIMHTTLNGDE---- 376
                     ..||.|:|::        |:.:..:|.  |:.|:|. .|..::....|...|    
 Worm   396 RVFMRNCVDKGNREEVAKL--------TETVKENVL--EMIRESD-SFTPSVKKRVLKKVEAIGA 449

  Fly   377 ------------RLDAAYHSILL-GRRSLYRNLEKLRKFQRTRRLASHSAQQVRRYAQMFAPVNA 428
                        .||..|.::.| ...|.|:..:||.:.:...::...:.|.....:.....|||
 Worm   450 IIGYPDHFDPPGTLDKEYENLTLDASDSYYKMSQKLHQLRLQHQMEFLAGQTPLSPSDQVLEVNA 514

  Fly   429 -FLGQHNLSTPLNYLLLGEFFSR------SLVAAG-------------SSSRTQGAWRSSDSERR 473
             :..:.|..|.|...|...||..      :|:..|             ...|..| |..::....
 Worm   515 HYDSKDNALTVLAPFLDDPFFDSTYPEYVNLIFTGFLIGHEFGHSIDPKILRRDG-WYKTEDMTE 578

  Fly   474 FAIFQQCV------------GKQTNAIDLLLSLLAQRQALSAYGQWLATQA--GLVERVDAVLAA 524
            :....||:            |||.|....:..::         |.|:....  ...:::|.    
 Worm   579 YGKRAQCLIDQYDNYDDPDHGKQMNGTYCIGEIV---------GDWVGRDVTWRAFKKMDL---- 630

  Fly   525 GSSKM---------SLQRLFFVTSLLVDC--RS--ELGALQQDRKRQVTHAT--------LRNSP 568
              |||         :|.:|:|....|..|  ||  .|..|..|     .|.|        ..|.|
 Worm   631 --SKMQKLIGFEDKNLDQLYFRIQSLFFCGPRSMKSLEQLLSD-----PHPTEVFRVNGIYSNMP 688

  Fly   569 EFLEAFRCRPGDVLYPQDQRC 589
            :|.:||.|..|..:.| :::|
 Worm   689 QFAKAFNCPIGSPMNP-EKKC 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nepl11NP_649449.1 GluZincin 45..589 CDD:301352 135/717 (19%)
nep-10NP_494532.2 M13 97..709 CDD:189000 136/721 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.