DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abs and CG9630

DIOPT Version :8

Sequence 1:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_649777.1 Gene:CG9630 / 40974 FlyBaseID:FBgn0037561 Length:613 Species:Drosophila melanogaster

Alignment Length:495 Identity:139/496 (28%)
Similarity:229/496 (46%) Gaps:94/496 (19%)


  Fly   174 PPIRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMF 238
            ||:..        .:|..:.:.|.:..||:|...:|.:||.:|:...|.|||||||.|::|::..
  Fly    12 PPLSD--------AVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEI 68

  Fly   239 ALEQEYSLPFERNEGPYG------LIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGL 297
                   |.....|.|:|      |:|.|:||||:|..|::..:.:|..   :..:...|.:||.
  Fly    69 -------LQRRHKETPWGPKEIGALVISPTRELARQISEVLAQFLEHED---LEHLNQQLIVGGN 123

  Fly   298 PVSEALDVISRGVH-IVVATPGRLMDMLDKKILTLDMC------RYLCMDEADRMIDMGFEEDVR 355
            .:.|.:..:.|... |:|.|||||.|:..:|...|::.      .:|.:|||||::|:||:..|.
  Fly   124 SIEEDIATLRRETPCILVCTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVN 188

  Fly   356 TIFSFFKGQRQTLLFSATMPKKIQNFARSALVKPVTINVGRAGAASMNVTQQVE----YVKQEAK 416
            .|..:...||:|.|||||...::.:..|:.|..||.::|..  .||:|...:::    .|:.|.|
  Fly   189 NILGYLPRQRRTGLFSATQTTEVTDLIRAGLRNPVLVSVKE--KASVNTPARLQNFYRIVEPELK 251

  Fly   417 VVYLLDCLQKTAP---PVLIFAEKKQDVDCIHEYL--LLKGVEAVAIHGGKDQEERSRAVDAYRV 476
            .|.||:.|...|.   .|::|......|:...|.|  ||.....:.|| ||.:.:|:..|:.:|.
  Fly   252 FVALLEFLSSPATVIGKVMVFFPTCACVEYWAEALPPLLPKRTVLGIH-GKMKNKRANVVEKFRN 315

  Fly   477 GKKDVLVATDVASKGLDFPNVQHVINYDMPDDIENYVHRIGRTGRSNTKGLA------------- 528
            ..:.||:.|||.::|||.|.::.|:.:|.|....::|||:|||.|...:|.|             
  Fly   316 TPQAVLLCTDVLARGLDVPEIEWVVQWDPPSTASSFVHRVGRTARQGNEGNALVFLLPSEDAYVH 380

  Fly   529 ----------TTLINKTTEQS--------VLLDLKHLLIEGKQEVPD-----FLDELAPETEHQ- 569
                      |.|:.:..|.:        .:||..|.|....:.|.|     |:..:...|:|: 
  Fly   381 FLKINQKVELTKLLTEEAEDADREKKKLPAVLDQLHRLQAADKGVYDKGMRAFVSHVRAYTKHEC 445

  Fly   570 -------HLDLGDSHGCTYCGGLGHRITECPKLEAVQNKQ 602
                   .||||..       ...:.:.:.|::..::|.|
  Fly   446 SAILRLKDLDLGKM-------ATAYGLLQLPRMPELKNYQ 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
absNP_524220.1 DEADc 179..393 CDD:238167 71/227 (31%)
DEXDc 192..397 CDD:214692 71/218 (33%)
Helicase_C 414..523 CDD:278689 40/114 (35%)
CG9630NP_649777.1 DEADc 6..226 CDD:238167 73/232 (31%)
DEXDc 22..232 CDD:214692 72/222 (32%)
HELICc 239..370 CDD:238034 43/132 (33%)
DUF4217 411..470 CDD:290667 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122986298
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24031
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.