DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abs and Dbp45A

DIOPT Version :8

Sequence 1:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_476927.1 Gene:Dbp45A / 35917 FlyBaseID:FBgn0010220 Length:521 Species:Drosophila melanogaster

Alignment Length:396 Identity:119/397 (30%)
Similarity:197/397 (50%) Gaps:50/397 (13%)


  Fly   188 ILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTGSGKTLVFVLPVIMFALEQEYSLPFERNE 252
            ::..|...|:|..||||.:.:|.:|||:|.||.|.||||||..|.||::....|:..|       
  Fly    18 LVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVS------- 75

  Fly   253 GPYGLIICPSRELAKQTHEIIQHYSKHLQACGMPEIRSCLAMGGLPVSEALDVISRGVHIVVATP 317
             .:.|::.|:.|||   ::|.:.:....||.|   :|.|:..||.........:.:..|||||.|
  Fly    76 -HFALVLTPTHELA---YQISEQFLVAGQAMG---VRVCVVSGGTDQMVESQKLMQRPHIVVAMP 133

  Fly   318 GRLMDMLDK-KILTLDMCRYLCMDEADRMIDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNF 381
            |||.|.|.. ...:.|..:||.:||||||::..|:|.:..|.......||.|.|||||    ::|
  Fly   134 GRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFSATM----KDF 194

  Fly   382 ARSALVKPVTINVGR----AGAASMNVTQQ-----VEYVKQEAKVVYLLDCLQKTAPP-----VL 432
            .:.:.:.|:..:...    :..|::....|     .:|.:.    :.|::.|:|....     |:
  Fly   195 IKESSIFPIASDCFEWSQDSDVATVETLDQRYLLCADYDRD----MVLIEALRKYREENENANVM 255

  Fly   433 IFAEKKQDVDCIHEYLLLKGVEAVAIHGGKDQEERSRAVDAYRVGKKDVLVATDVASKGLDFPNV 497
            ||...|:....:...|....::.|.:||...|:||..|:..::..:...|:|||||::|||.|:|
  Fly   256 IFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPSV 320

  Fly   498 QHVINYDMPDDIENYVHRIGRTGRSNTKGLATTLINKTTEQSVLLDLKHLLIEGKQEVPDFLDEL 562
            :.|:|:.:|...:.|:||:|||.|:..||::.::.....:..:|..:       ::|:...|   
  Fly   321 ELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIFRFPRDLELLAAI-------EEEINTKL--- 375

  Fly   563 APETEH 568
               |||
  Fly   376 ---TEH 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
absNP_524220.1 DEADc 179..393 CDD:238167 72/206 (35%)
DEXDc 192..397 CDD:214692 72/210 (34%)
Helicase_C 414..523 CDD:278689 36/114 (32%)
Dbp45ANP_476927.1 SrmB 8..490 CDD:223587 119/397 (30%)
DEADc 9..197 CDD:238167 71/197 (36%)
Helicase_C 239..346 CDD:278689 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122966445
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24031
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.