DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abs and CG6227

DIOPT Version :8

Sequence 1:NP_524220.1 Gene:abs / 40530 FlyBaseID:FBgn0015331 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_573020.2 Gene:CG6227 / 32464 FlyBaseID:FBgn0030631 Length:1224 Species:Drosophila melanogaster

Alignment Length:633 Identity:196/634 (31%)
Similarity:309/634 (49%) Gaps:88/634 (14%)


  Fly    16 EGDLDNEDYVPYVPVKERKKQHMIKLGRIVQLVSETA--------------------------QP 54
            |.|:..|.  |.|..|:..|:....:...:::|.|..                          :|
  Fly   301 EADIKKEP--PPVDTKKEIKKKPEPVAAKMEIVEEPTVAAGEKTKKEPEQPHVGAKSEPEVEDKP 363

  Fly    55 KSSSENENEDDSQGAH--DVETWGRKYN-----------ISLL-----DQHTELKK--IAEAKKL 99
            :..:|.|:|.|...|:  :|....|:.|           :.:|     .:.|.|||  :.| :.:
  Fly   364 QPEAEPEDEIDPLDAYMQEVNNEMRRVNNFVNPPAKSQGVVILTGVAKKKTTTLKKGEVIE-QNM 427

  Fly   100 SAVEKQLREEEKIMESIAQQKALMGVAELAK----GIQYEQPIKTAWKPPRYIREMSEEEREAVR 160
            .::|....:|.:.:...|...|:....||||    .:.|....|..:.....:..|:..:.|..|
  Fly   428 DSLEYSSEDELEDIRDTAVNLAMKHRKELAKIDHSSVTYAPFRKNFYVEVPELTRMTAADVEKYR 492

  Fly   161 HELR-ILVEGETPSPPIRSFREMKFPKGILNGLAAKGIKNPTPIQVQGLPTVLAGRDLIGIAFTG 224
            .:|. |.|:|:....||:::.:....|..:..|...|.:.|||||.|.:|.:::||||||||.||
  Fly   493 SDLEGIQVKGKGCPKPIKTWAQCGVSKKEMEVLRRLGFEKPTPIQCQAIPAIMSGRDLIGIAKTG 557

  Fly   225 SGKTLVFVLPVIMFALEQEYSLPFERNEGPYGLIICPSRELAKQTHEIIQHYSKHLQACGMPEIR 289
            |||||.|:||:....|:|.   ..|..:|...:|:.|:|||..|..:.|:.:||.|      .:|
  Fly   558 SGKTLAFILPMFRHILDQP---SMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSL------GLR 613

  Fly   290 SCLAMGGLPVSEALDVISRGVHIVVATPGRLMDML---DKKILTLDMCRYLCMDEADRMIDMGFE 351
            .....||..:||.:..:.||..|:|.||||::|||   ..::..|....|:.:||||||.|||||
  Fly   614 PVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFE 678

  Fly   352 EDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSALVKPVTINVGRAGAASMNVTQQVEYVKQEAK 416
            ..|..|....:..|||::||||.|::::..||..|.||:.:.||........|.|.|..:..:||
  Fly   679 PQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQHVVILNDDAK 743

  Fly   417 VVYLLDCL--QKTAPPVLIFAEKKQDVDCIHEYLLLKGVEAVAIHGGKDQEERSRAVDAYRVGKK 479
            ...||:.|  .:.|..:::|.:|:::.|.:...|:......:::|||.||.:|...:..::.||.
  Fly   744 FFKLLELLGIYQEAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIIDFKSGKV 808

  Fly   480 DVLVATDVASKGLDFPNVQHVINYDMPDDIENYVHRIGRTGRSNTKGLATTLINKTTEQS----- 539
            .:|:||.||::|||..::..|:|||:|:..|:||||.|||||:..||.|.|.|  |.|||     
  Fly   809 RLLIATSVAARGLDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFI--TPEQSRYAGD 871

  Fly   540 --VLLDLKHLLIEGKQEVPDFLDELAPETEHQHLDLGDSHGCT-YCGG 584
              ..:||...||..:.:        |..||::.|.  ::.|.| :.||
  Fly   872 IIRAMDLSGTLIPAELQ--------ALWTEYKALQ--EAEGKTVHTGG 909

Known Domains:


GeneSequenceDomainRegion External IDIdentity
absNP_524220.1 DEADc 179..393 CDD:238167 86/217 (40%)
DEXDc 192..397 CDD:214692 87/208 (42%)
Helicase_C 414..523 CDD:278689 41/111 (37%)
CG6227NP_573020.2 SrmB 482..967 CDD:223587 162/450 (36%)
DEADc 516..719 CDD:238167 86/212 (41%)
HELICc 733..860 CDD:238034 47/127 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122986383
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24031
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.