DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Cat and Ctnna2

Sequence 1:NP_524219.1 Gene:alpha-Cat FlyBaseID:FBgn0010215 Length:917 Species:Drosophila melanogaster
Sequence 2:XP_017448033.1 Gene:Ctnna2 RGDID:1305060 Length:966 Species:Rattus norvegicus

Alignment Length:962 Identity:584/963 (61%)
Similarity:735/963 (76%) Gaps:68/963 (7%)


  Fly     8 GTLTD-FGQIALKWDPKNLEIRTMSVEKTLEPLVLQVTTLVNT--KGPSKKKKGKSKRASALVAA 69
            |::|. ...|.||||||:|||||::||:.|||||.||||||||  ||||.||||:||:|..|.|:
  Rat    12 GSMTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAAS 76

  Fly    70 VEKATENFIQKGEQIAYENPDITQEMLTAVDEVKKTGDAMSIAAREFSEDPCSSLKRGNMVRAAR 134
            ||:||:||::||||||.|:.|:.:|::.||::|:|.|:.|.||:.||::|||||:|||.||||||
  Rat    77 VEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAAR 141

  Fly   135 NLLSAVTRLLILADMVDVHLLLKSLHIVEDDLNKLKNASSQDELMDNMRQFGRNAGELIKQAAKR 199
            .||||||||||||||.||..||..|.|||:.|..:|||:::.:|.:..::||:...:|...||:|
  Rat   142 ALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARR 206

  Fly   200 QQELKDPQLRDDLAAARAMLKKHSTMLLTASKVYVRHPELDLAKVNRDFILKQVCDAVNTISDVA 264
            |||||||..||::||||..|||::|||.|||:.::|||::...:.|||::.|||.:|:..||..|
  Rat   207 QQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISSAA 271

  Fly   265 QGKSSQPTDI---YSGAGELAAALDDFDEGIVMDPMTYSEKRSRQLLEERLESIISAAALMADAD 326
            |..|  |||.   ::|.|||||||::||..|::||||:||.|.|..||||||||||.||||||:.
  Rat   272 QATS--PTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSS 334

  Fly   327 CTRDERRERIVAECNAVRQALQDLLSEYMSNMSQKDNSPGLSRAIDQMCRKTRDLRRQLRKAVVD 391
            ||||:||||||||||||||||||||||||:|..:|:....|:.|||:|.:|||||||||||||:|
  Rat   335 CTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMD 399

  Fly   392 HVSDSFLETTTPLLDLIEAAKSGNEKKVREKSEIFTKHAEKLVEVANLVCSMSNNEDGVKMVRYA 456
            |:|||||||..|||.|||||||||||:|:|.:::|.:||.||||||||.||:||||:|||:||.|
  Rat   400 HISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMA 464

  Fly   457 AAQIESLCPQVINAASILTVRPNSKVAQENMTTYRQAWEVQVRILTEAVDDITTIDDFLAVSENH 521
            |.||:||||||||||..|..||.|||||:||..::..||.|||:|||||||||::||||:|||||
  Rat   465 ATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENH 529

  Fly   522 ILEDVNKCVMALQVGDARDLRATAGAIQGRSSRVCNVVEAEMDNYEPCIYTKRVLEAVKVLRDQV 586
            |||||||||:|||.||...|..|||||:||::||.:::.|||:|||..:||::||||.|:|.:.|
  Rat   530 ILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETV 594

  Fly   587 MMKFDQRVGAAVGALSNNSNKDVDENDFIDASRLVYDGVREIRRAVLMNRSSEDLDTDTEFEPVE 651
            |.:|.::|..|:.|||.|..:..:||:|||||||||||||:||:||||.|:.|:|:.|::||. |
  Rat   595 MPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQ-E 658

  Fly   652 DLTLETRSRSSAHTGDQTVDEYPDISGICTAREAMRKMTEEDKQKIAQQVELFRREKLTFDSEVA 716
            |  .:.|||:|..|.|..:     |:| .:||..|.::.:|:|.|||:|||:|.:||...|:|||
  Rat   659 D--YDVRSRTSVQTEDDQL-----IAG-QSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVA 715

  Fly   717 KWDDTGNDIIFLAKHMCMIMMEMTDFTRGRGPLKTTMDVINAAKKISEAGTKLDKLTREIAEQCP 781
            ||||:|||||.|||.||||||||||||||:||||.|.|||||||||:|||:::|||.|.:|:|||
  Rat   716 KWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCP 780

  Fly   782 ESSTKKDLLAYLQRIALYCHQIQITSKVKADVQNISGELIVSG---------------------- 824
            :|:.|:|||||||||||||||:.|.|||||:|||:.|||||||                      
  Rat   781 DSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGR 845

  Fly   825 --------------------------LDSATSLIQAAKNLMNAVVLTVKYSYVASTKYTR-QGT- 861
                                      |||||||||||||||||||||||.||||||||.: .|| 
  Rat   846 ASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTA 910

  Fly   862 -VSSPIVVWKMKAPEKKPLVRPEKPEEVRAKVRKGSQKKVQNPIHALSEFQS 912
             |:||:|.||||||||||||:.|||||.:.:||:|||||..:|:.|||||::
  Rat   911 AVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKA 962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatNP_524219.1 Vinculin 87..877 CDD:279395 508/844 (60%)
Ctnna2XP_017448033.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68394
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D405587at33208
OrthoFinder 1 1.000 FOG0001371
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130411
Panther 1 1.100 LDO PTHR18914
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.