DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Cat and ctnnal1

Sequence 1:NP_524219.1 Gene:alpha-Cat FlyBaseID:FBgn0010215 Length:917 Species:Drosophila melanogaster
Sequence 2:XP_012819651.1 Gene:ctnnal1 XenbaseID:XB-GENE-5815188 Length:794 Species:Xenopus tropicalis

Alignment Length:857 Identity:225/858 (26%)
Similarity:373/858 (43%) Gaps:186/858 (22%)


  Fly    25 LEIRTMSVEKTLEPLVLQVTTLVNTKGPSKKKKGKSKRASALVAAVEKATENFIQKGEQIAYENP 89
            |||:|.|||:||.|||.|:|||:|.|...||.:...:....:..||.:|...|:..||.||.||.
 Frog    25 LEIKTKSVEQTLIPLVSQITTLINHKEKPKKSEKTLQAIQRVGHAVNQAVGRFVAVGETIANENR 89

  Fly    90 DITQEMLTAVDEVKKTGDA------MSIAAREFSEDPCSSL---KRGNMVRAARNLLSAVTRLLI 145
            ::.:||..|..|.::.|:.      |:|:.|. ..|.|:::   |.| :|:|||.|||:||::|:
 Frog    90 ELKEEMGFACSEARRAGETIAQLTDMNISERP-DPDGCTTIFTDKIG-VVKAARLLLSSVTKVLV 152

  Fly   146 LADMVDVHLLLKSLHIVEDDLNKLKNASSQDELMDNMRQFGRNAGELIKQAAKRQQELKDPQLRD 210
            |||.:.|..::.|.:.|...:..|:..||..|.:....|||....|.......||.:||:.:.|.
 Frog   153 LADRIVVKQIIASRNKVLATMEHLEKVSSFQEFVQIFSQFGIEMVEFAHLTGDRQNDLKNEKKRA 217

  Fly   211 DLAAARAMLKKHSTMLLTASKVYVRHPELDLAKVNRDFILKQVCDAVNTISDVAQGKSSQ----- 270
            .:|||||:|:|.:.|||||||..:|||:.:.|..|::.:.:::..|:..:.::.......     
 Frog   218 SMAAARAVLEKCTMMLLTASKTCLRHPDCESACFNKEGVFQRMRLALEQVVEIVTDSRPNGECEI 282

  Fly   271 -PTDIYSGAGELAAALDDFDEGIVMDPMTYSEKRSRQLLEERLESIISAAALMADADCTRDERRE 334
             |..||:|..|....:    ||: .|.:.|..|.:   :...||.|:.......|:..|..|.||
 Frog   283 VPISIYTGIKEFKNKI----EGL-RDNLYYLSKEN---VSTMLEVILEHTEDFTDSAYTSHENRE 339

  Fly   335 RIVAECNAVRQALQDLLSEYMSNMSQ--KDNSPGLSRAIDQMCRKTRDLRRQLRKAVVDHVSDSF 397
            .|:...|..::.|:.|:|.:|...:|  ||....|..||.:||:...:|:|:|..|.....:|..
 Frog   340 HILELSNQAKKELEQLVSVWMQAQAQKTKDIMEDLELAILKMCQCITELKRELHNAATVLAADLL 404

  Fly   398 LETTTPLLDLIEAAK----SGNEKKVREKSEIFTKHAEKLVEVANLVCSMSNNEDGVKMVRYAAA 458
            ...|..:  :::|.|    .||.:.|.|.:...|:..|:|||...|:..:|..|           
 Frog   405 KHHTEHM--VLKALKIAGTEGNLEAVAEYTCKLTEQKEQLVETCRLLRHVSGTE----------- 456

  Fly   459 QIESLC-----------PQVINAASILTVRPNSKVAQENMTTYRQAWEVQVRILTEAVDDITTID 512
            .:|..|           ||:::||..|.:.|.||:|:||:..:.:|||.|       ::|::.  
 Frog   457 PLEITCIHAEDTFHVSGPQIVSAAETLALHPTSKIAKENLDVFCEAWESQ-------LNDMSV-- 512

  Fly   513 DFLAVSENHILEDVNKCVMALQVGDARDLRATAGAIQGRSSRVCNVVEAEMDNYEPCIYTKRVLE 577
                     :|.::|                  ...:||...                  ||...
 Frog   513 ---------LLREIN------------------DVFEGRRGE------------------KRAYL 532

  Fly   578 AVKVLRDQVMMKFDQRVGAAVGALSNNSNKDVDENDFIDASRLVYDGVREIRRAVLMNRSSEDLD 642
            ::            .|.||....|       :|:..|:....:.|.     :|.:..:::..:.:
 Frog   533 SL------------PRPGATTTGL-------IDQGIFLITLNIFYH-----QRGLKKHQTKHNSN 573

  Fly   643 TDTEFEPVEDLTLETRSRSSAHTGDQTVDEYPDISGICTAREAMRKMTEEDKQKIAQ---QVELF 704
            ..| .:||                                     |:..|::.|||:   :|.|.
 Frog   574 LKT-LKPV-------------------------------------KLDVEEQGKIAKLGLEVRLL 600

  Fly   705 RREKLTFDSEVAKWDDTGNDIIFLAKHMCMIMMEMTDFTRGRGPLKTTMDVINAAKKISEAGTKL 769
            ..:   .|||..||:|..|:::...:.|..:...|..||||.|.||||.|:.:.|:..:.||.|.
 Frog   601 SSD---VDSEAEKWEDQENEVVRNGQSMSSMAYTMYLFTRGEGLLKTTQDLFHQAEVFATAGLKF 662

  Fly   770 DKLTREIAEQCPESSTKKDLLAYLQRIALYCHQIQITSKVKADVQNISGELIVSGLDSATSLIQA 834
            ..:....:.|. |...|..||..::::.....|:|||::..     :.|:  .:......:.||.
 Frog   663 SSVLHAFSNQL-EDDDKPLLLLEIEKLIPLSQQLQITARTP-----VQGK--TATFTKVDTCIQK 719

  Fly   835 AKNLMNAVVLTV 846
            :|.:| .:||.|
 Frog   720 SKAMM-IIVLQV 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatNP_524219.1 Vinculin 87..877 CDD:279395 197/796 (25%)
ctnnal1XP_012819651.1 Vinculin 87..>520 CDD:279395 135/492 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.