DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Cat and ctnna2

Sequence 1:NP_524219.1 Gene:alpha-Cat FlyBaseID:FBgn0010215 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_001090774.1 Gene:ctnna2 XenbaseID:XB-GENE-5955201 Length:966 Species:Xenopus tropicalis

Alignment Length:966 Identity:575/967 (59%)
Similarity:730/967 (75%) Gaps:80/967 (8%)


  Fly    16 IALKWDPKNLEIRTMSVEKTLEPLVLQVTTLVNT--KGPSKKKKGKSKRASALVAAVEKATENFI 78
            |.||||||:|||||::||..|||||.||||||||  ||||.||||:||:|..|.|:||:||:||:
 Frog     8 IILKWDPKSLEIRTLTVESLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFL 72

  Fly    79 QKGEQIAYENPDITQEMLTAVDEVKKTGDAMSIAAREFSEDPCSSLKRGNMVRAARNLLSAVTRL 143
            :||||||.|:.|:.:|:::||::|:|.||.|.|.:.||::|||||:|||.||||||.||||||||
 Frog    73 EKGEQIAKESQDLKEELISAVEDVRKQGDTMRITSSEFADDPCSSVKRGTMVRAARALLSAVTRL 137

  Fly   144 LILADMVDVHLLLKSLHIVEDDLNKLKNASSQDELMDNMRQFGRNAGELIKQAAKRQQELKDPQL 208
            ||||||.||..||..|.|||:.|..:|||:::.:|....::||:...:|...||:||||||||..
 Frog   138 LILADMADVMRLLIHLKIVEEALESVKNATNEQDLAHRFKEFGKEMVKLNYVAARRQQELKDPHC 202

  Fly   209 RDDLAAARAMLKKHSTMLLTASKVYVRHPELDLAKVNRDFILKQVCDAVNTISDVAQGKSSQPTD 273
            ||::||||..|||::|||.|||:.::|||::...:.|||::.|||.:|:..|::.||..|  |||
 Frog   203 RDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGIANAAQATS--PTD 265

  Fly   274 ---IYSGAGELAAALDDFDEGIVMDPMTYSEKRSRQLLEERLESIISAAALMADADCTRDERRER 335
               .::|.|||||||::||..|::||:|:||.|.|..|||:||||||.||||||:.||||:||||
 Frog   266 EKQAHTGIGELAAALNEFDNKIILDPLTFSEARFRPSLEEKLESIISGAALMADSSCTRDDRRER 330

  Fly   336 IVAECNAVRQALQDLLSEYMSN------------MSQKDNSPGLSRAIDQMCRKTRDLRRQLRKA 388
            ||||||:|||||||||||||:|            ..:|:....|:.|||:|.:||||||||||||
 Frog   331 IVAECNSVRQALQDLLSEYMNNCRYGTWMDESCKSGRKEKGDPLNIAIDKMTKKTRDLRRQLRKA 395

  Fly   389 VVDHVSDSFLETTTPLLDLIEAAKSGNEKKVREKSEIFTKHAEKLVEVANLVCSMSNNEDGVKMV 453
            |:||:|||||||..|||.||||||:||||:|:|.:::|.:||.||||||||.||:||||:|||:|
 Frog   396 VMDHISDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLV 460

  Fly   454 RYAAAQIESLCPQVINAASILTVRPNSKVAQENMTTYRQAWEVQVRILTEAVDDITTIDDFLAVS 518
            |.||.||:||||||||||..|..||.|||||:||..::..||.|||:|||||||||::||||:||
 Frog   461 RMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVS 525

  Fly   519 ENHILEDVNKCVMALQVGDARDLRATAGAIQGRSSRVCNVVEAEMDNYEPCIYTKRVLEAVKVLR 583
            ||||||||||||:|||.||...|..|||||:||::||.:::.|||:|||..:||::||:|.|:|.
 Frog   526 ENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLDATKLLC 590

  Fly   584 DQVMMKFDQRVGAAVGALSNNSNKDVDENDFIDASRLVYDGVREIRRAVLMNRSSEDLDTDTEFE 648
            :.||.:|.::|..|:.|||.|..:..:||:|||||||||||||:||:||||.|:.|:|:.|::||
 Frog   591 ETVMPRFAEQVEFAIEALSANIPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFE 655

  Fly   649 PVEDLTLETRSRSSAHTGDQTVDEYPDISGICTAREAMRKMTEEDKQKIAQQVELFRREKLTFDS 713
            . ||  .:.|||:|..|.|..:     |:| .:||..|.::.:|:|.|||:|||:|.:||...|:
 Frog   656 Q-ED--YDVRSRTSVQTEDDQL-----IAG-QSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDA 711

  Fly   714 EVAKWDDTGNDIIFLAKHMCMIMMEMTDFTRGRGPLKTTMDVINAAKKISEAGTKLDKLTREIAE 778
            |||||||:|||||.|||.||||||||||||||:||||.|.|||||||||:|||:::|||.|.:|:
 Frog   712 EVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVAD 776

  Fly   779 QCPESSTKKDLLAYLQRIALYCHQIQITSKVKADVQNISGELIVSG------------------- 824
            |||:|:.|:||:||||||||||||:.|.|||||:|||:.|||||||                   
 Frog   777 QCPDSACKQDLIAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTAVQSTFTTFYEVAGDVIA 841

  Fly   825 ------------------------------LDSATSLIQAAKNLMNAVVLTVKYSYVASTKYTR- 858
                                          |||||||||||||||||||||||.||||||||.: 
 Frog   842 GGRDSQLSLDLLPSCTEGSLFGSGSRDSTMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKV 906

  Fly   859 QGT--VSSPIVVWKMKAPEKKPLVRPEKPEEVRAKVRKGSQKKVQNPIHALSEFQS 912
            .||  |:||:|.||||||||||||:.|||||.:.:||:|||||..:|:.|||||::
 Frog   907 YGTAAVNSPVVSWKMKAPEKKPLVKREKPEEYQTRVRRGSQKKHISPVQALSEFKA 962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatNP_524219.1 Vinculin 87..877 CDD:279395 501/857 (58%)
ctnna2NP_001090774.1 Vinculin 81..927 CDD:279395 501/857 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H68394
Inparanoid 1 1.050 1069 1.000 Inparanoid score I230
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D405587at33208
OrthoFinder 1 1.000 FOG0001371
OrthoInspector 1 1.000 T600797
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2575
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.