DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nrm and side-VII

Sequence 1:NP_001246890.1 Gene:nrm FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster
Sequence 2:NP_001262432.1 Gene:side-VII FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster

Alignment Length:705 Identity:163/706 (23%)
Similarity:268/706 (38%) Gaps:148/706 (21%)


  Fly    25 ISLSLVLVLCLALVDSSTAQVDTTISQQES---QSVVLPCPVDAEKCGKLHSLNWFKGDDRIAAM 86
            :.|.|:.:|.|.|::||....|..|.|.||   :::.|||.|..           :.||:.:..:
  Fly     1 MELLLLFMLALQLIESSIGSKDVPIHQIESIVGENIYLPCNVTT-----------YDGDEPVLVL 54

  Fly    87 LLGDSNVTSV------------------NKEFDERV--TVEQNPYRLVIKDLKIADEDIYLCDTT 131
            ...|...|.:                  :..|.:|.  ..::.|.:|.|::.:.:|...|.|...
  Fly    55 WYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQASDSGTYRCRVD 119

  Fly   132 FFIPEETCDNFNGYRIELRVLVPPTEVVILDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQP 196
             |:..:|.::    ||.|.|:.||.:|:|.|:  ..::..:||||..|...:...|.|....|.|
  Fly   120 -FLKAQTINS----RIRLNVISPPKQVIIRDS--SNVERSTVVGPYSEGDIVSLKCQVIGGYPTP 177

  Fly   197 EVSWFRGTKRLTTYSPTHDLVDGLYT----------STLELDWT---LSREDLAQDIECRVKSAA 248
            .:||:|               ||:..          ..:|.:.|   |.||||...:.||..|..
  Fly   178 TISWYR---------------DGIEIPCELSHLAGGKIIECEITLPSLGREDLNSRLTCRALSHP 227

  Fly   249 IQNVTVTKFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVNLTWY-------NTTTI 306
            ...:......:|:...|.:|.:.|.......|.:..|.|...|:||...:||:       .||..
  Fly   228 RAPIVEAVVQIDMNFAPLNIRLLGAHQPLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKTTET 292

  Fly   307 ISSGENEITEVRSKSLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALTL 371
            .||..|:.|...|.||.|||.                 .:...|:|.|..:.   .:|:.....|
  Fly   293 TSSDGNQTTSTLSISLSKSDA-----------------GKYLSCKAYNHAVP---SEPLEDGWKL 337

  Fly   372 EVLYPPVVKV------SPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVNDTTHYKGG 430
            ::.|.|...|      .||.:...|.  |..:|...|:| ::.::||..|:..::.|.:.   |.
  Fly   338 DIQYVPEAYVRLGTSLDPSTLREGTD--VYFDCLVMAHP-NVFRIEWRHNEQPLSHNISL---GV 396

  Fly   431 NSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPT-VEILMIPEGPVKESDESN 494
            ...|.:||::...:...|||||...|..|:|.| ....|::.|||| .:......|..|:.|   
  Fly   397 IISNHSLVLQGVTRATAGNYSCVGFNAEGEGIS-APFALNILYAPTCAQNQKKVYGIAKQED--- 457

  Fly   495 VTLFCNVLDANPSVLTKVRWYANST----------LLKELPDCEETREDLCHIDPSKLLLESIGR 549
            ..:.|.| ||||..: :..|..|::          :::.......|...:..:|...||      
  Fly   458 AKVMCTV-DANPREV-EFSWTFNNSAESIDVATNHIIRSGTTSIVTYTPITELDYGTLL------ 514

  Fly   550 GFFYNYSCEGFNAAGWGPRSEDKELLVHYEPG--PAALSHFPLVAVKKKSVTFSCSVD-DPGFPE 611
                   |...|..|    .:....:.|....  |..:.:..:..:...|:|.:||.. :.|.|:
  Fly   515 -------CLASNKIG----KQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQ 568

  Fly   612 SNRFRWLRGGRGPLQDIVTK---DWTVEPVGLDSRTNYSCYAYNEGGKGVMATVN 663
            |.....|......::..:|.   .:||..:...|....:.||:|..|:...|.||
  Fly   569 SFNLELLDSYTQEIKANITSTIPKFTVPGLSPGSIYRLNIYAFNTKGRSDPAIVN 623

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nrmNP_001246890.1 Ig 44..152 CDD:299845 27/131 (21%)
Ig 176..248 CDD:299845 21/85 (25%)
Ig 277..354 CDD:299845 22/84 (26%)
IG_like 383..463 CDD:214653 23/80 (29%)
Ig 394..463 CDD:143165 20/69 (29%)
Ig_3 585..652 CDD:290638 14/71 (20%)
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 21/118 (18%)
V-set 32..134 CDD:284989 21/118 (18%)
IGc2 160..>214 CDD:197706 15/69 (22%)
Ig 262..328 CDD:299845 22/86 (26%)
IG_like 264..323 CDD:214653 21/76 (28%)
IGc2 360..425 CDD:197706 19/71 (27%)
Ig_3 456..519 CDD:290638 14/81 (17%)
FN3 538..620 CDD:238020 17/82 (21%)
FAM176 643..741 CDD:291517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.