DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12768 and CG6276

Sequence 1:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster

Alignment Length:479 Identity:89/480 (19%)
Similarity:152/480 (32%) Gaps:180/480 (38%)


  Fly    12 RLIELVRLNPILWDCRLPHYKRSDKRKAIK--WNELGRLFNVNGERVQRTFTSLREIFRRELNHE 74
            :|||:|:.:..:::   |.:|....|..::  |.|:......|.......:|:||..||||.   
  Fly    32 KLIEIVQRDEAIYN---PRHKYYFCRPYVENFWREVDLKLEKNPGASLAKWTNLRISFRREY--- 90

  Fly    75 KMLGTTRFKSK----WEYYDAMAFLKEVIRERKSRERIKHGSLDS-APVATGSSNNNNNCVSRN- 133
                |...:.|    |.|:|.|.||...:|::..:.:    |||: ...|....:|.::.:.|. 
  Fly    91 ----TNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPK----SLDTQVQDALAHLSNLSSRMQRER 147

  Fly   134 ----------------SSNNNSSSAALDEY-QYFAPSDPNNPN---------------------- 159
                            |::.:..:..||.| .||..::.||..                      
  Fly   148 SVTIPGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGN 212

  Fly   160 -----------------NQPQLQPEPKSSLPVTIPSLSLTLSQ---------------LPVALQQ 192
                             ::|:...:....|....|:.|.:.::               ||..||.
  Fly   213 DIKSECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSSSSSAEAQRRYANQHSHASRMLPGRLQM 277

  Fly   193 QAQH----------LQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSSSP 247
            :..|          .|.|| .|...:..:...:.||:..|.:......:.|..::|::       
  Fly   278 RTYHDEMRGAIRPRSQELQ-APTAAVAGVNYSAQPTAHPNISFVRPTFSKPVDLVSTT------- 334

  Fly   248 SIYIKDEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQQLKARLQLPTP------------- 299
                     :.|||       |.|...         |.|....:|  :||||             
  Fly   335 ---------THAGG-------GGGGGV---------PGTAGLSEA--ELPTPSTAAVATPMAPSS 372

  Fly   300 ----KNSSSYATS--------------PPH---LIINANNELIDTDAGDLEE---DLDDFDEDDD 340
                .:||||.:.              ||.   |.:.|||    ...|.:..   :|.|...|.|
  Fly   373 SVSASSSSSYLSQRHGHNHMHGGHPQVPPSALPLRLEANN----ASGGSVSNGGAELCDCKTDPD 433

  Fly   341 VTGRCSPIVGQSETMGAD-GRLSV 363
            .....|.:....:..|.| |::.:
  Fly   434 AMFLMSLLPDIQKLNGRDRGKIKI 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 25/94 (27%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 25/94 (27%)
BESS 431..465 CDD:281011 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48416
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.