DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12768 and Mes2

Sequence 1:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_730768.1 Gene:Mes2 FlyBaseID:FBgn0037207 Length:437 Species:Drosophila melanogaster

Alignment Length:464 Identity:131/465 (28%)
Similarity:188/465 (40%) Gaps:130/465 (28%)


  Fly     5 RHNIEKRRLIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRR 69
            |:..:|.:||::|..||||||.|||::|.:::.|...|..:||.||..|.||.|.|.||||.:||
  Fly    55 RNASDKLKLIQMVHDNPILWDSRLPNFKGAEEEKNRAWEHIGREFNAPGRRVARAFKSLRESYRR 119

  Fly    70 ELNHEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSRNS 134
            ||.|.|::| ..||.||..|:||.||::||||||....    :.|.:....|..|||||      
  Fly   120 ELAHVKLMG-NGFKPKWSLYEAMDFLRDVIRERKGASH----ATDLSLTTYGHINNNNN------ 173

  Fly   135 SNNNSSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSLSLTLSQLPVALQQQAQHLQA 199
            :||||:|.|...                              .:::|.||.   :..:.|..|. 
  Fly   174 NNNNSNSLAAGG------------------------------KAMTLKLSN---SFNESASVLN- 204

  Fly   200 LQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSSSPSIYIKDE-PCSPAGGCP 263
                                        |::.|...|......|    ..|:|.| ..|..||..
  Fly   205 ----------------------------LSKCSSLNVSDDHYYC----DYYVKPELDLSVGGGAG 237

  Fly   264 EEV---MTGNGPEATRKKLATIRPQTKQQLKARLQLPTPKNSS-----SYATSPPHLIINANNEL 320
            ...   .:|.||          .|....|.....::.:.:|..     ||.......|.:.:.::
  Fly   238 SSTSGSSSGGGP----------LPLPAHQAHNDSRVSSTRNEQRAQHHSYEDMDDSSIRSGDEDI 292

  Fly   321 IDTDAGDLEEDLDDFDEDD------DVTGRCSPIVGQSE-TMGADGRLSV-----------GSIY 367
              ..|.|:.|:||..|.|.      |...|.||.||..: .|....|.:|           |...
  Fly   293 --AHASDVVEELDAIDADFPYPLILDSNSRGSPNVGVDDVVMSRKLRRNVDQDVLEEGNGHGDAV 355

  Fly   368 IGDGGDCGRGMGRAHTQARH----------VP---TSRELLYMKFGDFLAARLNTLHETVANELM 419
            | ||.|....|.:.|...|.          :|   |.||:|..||..|::|:||::.::.|:.||
  Fly   356 I-DGDDYEEQMLQQHRHLRQQQGVASGGLDLPPPQTVREVLNSKFCGFISAKLNSMEDSDADNLM 419

  Fly   420 NKMLLLIAE 428
            |::|||:.:
  Fly   420 NRILLLLVQ 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 46/88 (52%)
Mes2NP_730768.1 MADF 62..149 CDD:214738 46/88 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130711032
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.