DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12768 and CG11723

Sequence 1:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster

Alignment Length:342 Identity:63/343 (18%)
Similarity:117/343 (34%) Gaps:115/343 (34%)


  Fly    12 RLIELVRLNPILWDCRLP-HYKRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEK 75
            |||:.|.....|||..:. .|:..|  .|::|..:.::...:....::.|..:|:.:|.|:   :
  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQD--AALQWASVAQIMQQDVSICKKRFKGMRDSYRAEV---R 66

  Fly    76 MLGTTRFK-SKWEYYDAMAFLKEV--------------IRERKSRE-----RIKHGSLD------ 114
            .:...|.: |.|.|:.::.|::::              :...:..|     |:...::|      
  Fly    67 KIQQKRIEMSHWPYFRSLEFMRQIFDPEGLVPFPPEPFVMNTEQPEVFEPTRLVDFAIDLDLDND 131

  Fly   115 ----------------SAPVATGSSNNNNNCVSRNSSNNNSSSAA--------------LDEYQY 149
                            |.|..:||...     |.....::|||.|              |..:|.
  Fly   132 DSVDFEIIEDIFKREPSVPQDSGSDKG-----SLIKPLDSSSSGAHRSDQDLSPTLPIHLPRHQQ 191

  Fly   150 FAPSDP----------NNPNN-----------------QPQLQ------------PEPKSSLPVT 175
            |.|..|          .:|:|                 :|.|:            |..||...::
  Fly   192 FLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDSDLSFLMSMMPHVKSLSAIS 256

  Fly   176 IPSLSLTLSQLPVALQQQAQHLQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSS 240
            .....:.::::.|.|:::.||:.|.....||         |..|:...||||.:..:.....|..
  Fly   257 NLKFRMEMARVLVELREEDQHMLAAAGPEDV---------LERSMPKLTPAPNSSFATQLEKSQY 312

  Fly   241 RSCSSSPSIYIKDEPCS 257
            ...:||..|..:..|.|
  Fly   313 HLSNSSYQISSRKTPTS 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 20/104 (19%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 20/89 (22%)
BESS 236..270 CDD:281011 4/34 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48380
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.