DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12768 and CG4404

Sequence 1:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster

Alignment Length:296 Identity:65/297 (22%)
Similarity:110/297 (37%) Gaps:49/297 (16%)


  Fly    12 RLIELVRLNPILWDCRLPHY-KRSDKRKAIKWNELGRLFNVNGERVQRTFTSLREIFRRELNHEK 75
            |.::.|...|.||:...|.| |:.|.::|  |.::...........:..:.::|..|.|.|   |
  Fly    17 RFVQFVENQPCLWNYTHPGYSKKEDVQRA--WQQVANDIKDTVRNCRERWRTIRSSFLRSL---K 76

  Fly    76 MLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKH--GSLDSAPVATGSSNNNNNCVSRNSSNNN 138
            :..|...:.|.:|| ...:|:.::...|||...|.  |.:...|....::...:..|:.......
  Fly    77 LARTQTGRGKRKYY-LSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAEEEAKV 140

  Fly   139 SSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSL------SLTLSQLPVALQQQA--- 194
            |......:.|.   |:..:..||.|.:.:|.:.||:.:.|:      |....||...:.||:   
  Fly   141 SDGEMPLDVQV---SEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVS 202

  Fly   195 -------QHLQALQLQPDVTLTSLQKQSLPTSLTNATPAPLAQTSPAQVLSSSRSCSSSPSIYIK 252
                   .||.    ..|:|.......|....||..|..|.:...|.|..:|:.|..:.      
  Fly   203 VPAAALGNHLG----WSDLTQWFKGHGSGHHKLTTTTTTPTSPPPPPQPATSALSVFTG------ 257

  Fly   253 DEPCSPAGGCPEEVMTGNGPEATRKKLATIRPQTKQ 288
                .|.||       |:.|:|....|.::.|..|:
  Fly   258 ----GPGGG-------GSQPDADYSFLISLHPYIKE 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 21/89 (24%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 21/92 (23%)
BESS 267..301 CDD:281011 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49010
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.