DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12768 and madf-4

Sequence 1:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_505565.3 Gene:madf-4 WormBaseID:WBGene00011575 Length:329 Species:Caenorhabditis elegans

Alignment Length:268 Identity:53/269 (20%)
Similarity:99/269 (37%) Gaps:61/269 (23%)


  Fly    13 LIELVRLNPILWDCRLPHYKRSDKRKAIKWNELGRLFNVNGERV--QRTFTSLREIFRRELNHEK 75
            ||:.|:.||.:::...|.:|.:|.:..| |..:......:|:.|  :|.:..:|:.:.|....:|
 Worm    22 LIDSVQRNPCVYNRYDPLHKVTDYKHEI-WKLISIEIGYDGQPVELERKWKHMRDKYVRLRKQDK 85

  Fly    76 MLGTTRFKSKW-EYYDAMAFLKEVI--RERKS-------------------------RERIKHGS 112
            .....:..:|| .||..|:||...:  |.||.                         :|.:|..|
 Worm    86 QKAPIKKTNKWYNYYHKMSFLDPYVEHRNRKRQKDYLNSNTPDFLDDDTAFLDGLSVKEMLKPES 150

  Fly   113 LDSAPVATGSSNNNNNCVSRNSSNNNS---SSAALD----------EYQYFAPSDPNNPNNQPQL 164
            |.::..|..:|.:..:..|.:.||||.   .|..:|          .|..|..:...|..|....
 Worm   151 LLTSNDAGYNSPHTTSSSSSSGSNNNGRFLDSPTIDIEDDKKNLALIYDKFVANQTENEKNHRFS 215

  Fly   165 QPEPKSSLPVTIPSLSLTLSQLPVALQQQAQHLQALQLQPDVTLTSLQKQSLPTSLTNATPAPLA 229
            ....|..|..|..:|                 ::.|........:|.:::.:|..:..::|.|..
 Worm   216 NKHGKDLLFSTTNTL-----------------IEKLATTSTAPSSSRKRKPIPVQILPSSPPPQE 263

  Fly   230 QTSPAQVL 237
            :.:..::|
 Worm   264 KNTKIELL 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12768NP_001262229.1 MADF 12..100 CDD:214738 23/92 (25%)
madf-4NP_505565.3 MADF 22..111 CDD:214738 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130711080
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.