DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP4F3 and Cyp6a8

Sequence 1:NP_000887.2 Gene:CYP4F3 HGNCID:2646 Length:520 Species:Homo sapiens
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:418 Identity:110/419 (26%)
Similarity:200/419 (48%) Gaps:44/419 (11%)


Human   123 VFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILK----PYMKIFNESVNIMHAKWQLLAS 183
            :||:.....:...|....|.:|...|..|:..|....:|    ..:.:.||.:.:||.|    ..
  Fly   108 IFYNEKDDPISAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEK----VP 168

Human   184 EGSARLDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVTKRHQQILLYIDFLY 247
            :.|. |::.:.::..|:|.:..|.|... :..:::.:|::  .....:||.|||..:|......|
  Fly   169 KNSV-LEIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFL--YFGKRSLVDKRHGTLLNGFMRSY 230

Human   248 YLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKD----- 307
                  .:..|...:|.  |...|||....:.::.|  .::.|...|..||:|:|:..|:     
  Fly   231 ------PKLARKLGMVR--TAPHIQEFYSRIVTETV--AVREKEHIKRNDFMDMLIELKNQKEMT 285

Human   308 -EDG---KKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPK 368
             |:|   :.|:.|::.|:|..|...|.:|::|.:.:.||.|||:|:.|::.|.||:|:::..: :
  Fly   286 LENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHD-Q 349

Human   369 EIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLP--DGRVIPKGIICLISVFGTHHNP 431
            ...::....|.:|...:.|:|||:..||.:.|...:..|:|  ...||..|...:|.....||:|
  Fly   350 NFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDP 414

Human   432 AVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVL---- 492
            :::|:|..:.|.||.|:....|..:|::||..|||||||..|...:.::.|.|.:..|:..    
  Fly   415 SIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSK 479

Human   493 ---PDHTEPRRKPELVLRAEGGLWLRVE 517
               |...:|:   ..||..:.|::|:||
  Fly   480 TPNPLVYDPK---SFVLGVKDGIYLKVE 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP4F3NP_000887.2 p450 52..515 CDD:278495 108/415 (26%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 108/416 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.