DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and EMC4

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_011283.1 Gene:EMC4 SGDID:S000003200 Length:190 Species:Saccharomyces cerevisiae

Alignment Length:196 Identity:63/197 (32%)
Similarity:97/197 (49%) Gaps:43/197 (22%)


  Fly     3 AKQNPKKLKWA---LD------FNGSKNADIPSPLGYNPSALVNQSEVVRDQR------------ 46
            ::|.|  .:||   ||      :|...:..:|||.|:..::  ::..|.|.|:            
Yeast     2 SEQEP--YEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNS--SKGNVTRKQQDATSQTTSLAQK 62

  Fly    47 -----LVIKKSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMA 106
                 |.::|:|.:||.|.|:||||:|:.||||.|:.|.|||...|:|..||||||:|:...|..
Yeast    63 NQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPV 127

  Fly   107 EGAQGTGQRI-------VYFLGNLANVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGIS 164
            .|.:.|..::       :.|.|.|  :.:...|..||||:|....|||    |..|:.:|..|:.
Yeast   128 LGNKATQSQVQTAMFMYIVFQGVL--MYIGYRKLNSMGLIPNAKGDWL----PWERIAHYNNGLQ 186

  Fly   165 F 165
            :
Yeast   187 W 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 47/133 (35%)
EMC4NP_011283.1 DUF1077 60..176 CDD:310781 46/122 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C223227657
eggNOG 1 0.900 E1_KOG3318
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1534
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 1 1.000 T1136552
orthoMCL 1 0.900 OOG5_128239
Panther 1 1.100 LDO PTHR19315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2002
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.