DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and EMC4

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_011283.1 Gene:EMC4 / 852620 SGDID:S000003200 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:63/196 - (32%)
Similarity:97/196 - (49%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKQNPKKLKWA---LD------FNGSKNADIPSPLGYNPSALVNQSEVVRDQR------------ 46
            ::|.|  .:||   ||      :|...:..:|||.|:..::  ::..|.|.|:            
Yeast     2 SEQEP--YEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNS--SKGNVTRKQQDATSQTTSLAQK 62

  Fly    47 -----LVIKKSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMA 106
                 |.::|:|.:||.|.|:||||:|:.||||.|:.|.|||...|:|..||||||:|:...|..
Yeast    63 NQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPV 127

  Fly   107 EGAQGTGQRI-------VYFLGNLANVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGIS 164
            .|.:.|..::       :.|.|.|  :.:...|..||||:|....|||    |..|:.:|..|:.
Yeast   128 LGNKATQSQVQTAMFMYIVFQGVL--MYIGYRKLNSMGLIPNAKGDWL----PWERIAHYNNGLQ 186

  Fly   165 F 165
            :
Yeast   187 W 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 47/132 (36%)
EMC4NP_011283.1 DUF1077 60..176 CDD:399428 43/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343318
Domainoid 1 1.000 81 1.000 Domainoid score I1999
eggNOG 1 0.900 - - E1_KOG3318
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54843
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 1 1.000 - - oto99482
orthoMCL 1 0.900 - - OOG6_102320
Panther 1 1.100 - - LDO PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 1 1.000 - - X4099
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.