DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and AT5G10780

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001078568.1 Gene:AT5G10780 AraportID:AT5G10780 Length:187 Species:Arabidopsis thaliana

Alignment Length:165 Identity:49/166 (30%)
Similarity:87/166 (52%) Gaps:21/166 (13%)


  Fly    11 KWALDFNGS----KNADIPSPLGYNPSALVNQSEVVRDQR------LVIKKSWDLALGPLKNIPM 65
            :||::|:..    .:.||..|.|::.::..........|:      ..::|:|::|..|.||:.|
plant    13 RWAVEFSDQSTVPSSRDILDPPGFSRASQEQDDSANSRQKKDAEATWKLQKAWEVAQSPFKNLMM 77

  Fly    66 NLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEGAQGTG-----QRIVYFLGNLAN 125
            ..|:|:|:||::.:|.|.:....|.:||.|:   |...|:.|..:...     .::|:...||..
plant    78 MGFMMWMAGNTVHLFSIGITFSALWQPISAL---QSVGKIFEPFKDNKVELLMPKLVFLALNLGG 139

  Fly   126 VALALYKCQSMGLLPTHASDWLAFVQP---QTRLE 157
            :||.::|..::||||||||||::.:.|   .||.|
plant   140 LALGVWKLNTLGLLPTHASDWVSSLPPPQLNTRAE 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 38/120 (32%)
AT5G10780NP_001078568.1 DUF1077 51..166 CDD:283955 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5879
Inparanoid 1 1.050 76 1.000 Inparanoid score I2349
OMA 1 1.010
OrthoDB 1 1.010 D1623701at2759
OrthoInspector 1 1.000 T192830
orthoMCL 1 0.900 OOG5_128239
Panther 1 1.100 LDO PTHR19315
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.