DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and EMC4

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_057538.1 Gene:EMC4 HGNCID:28032 Length:183 Species:Homo sapiens

Alignment Length:169 Identity:87/170 (51%)
Similarity:112/170 (66%) Gaps:13/170 (8%)


  Fly     8 KKLKWALDFN------------GSKNADIPSPLGYNPSALVNQSEVVRDQRLVIKKSWDLALGPL 60
            ::.|||::.:            ||...|...|:||....:.:.|....|:.||.|:.||:|||||
Human    13 RRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPL 77

  Fly    61 KNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAE-GAQGTGQRIVYFLGNLA 124
            |.||||||||||:||:|||||.|||.||..|||:|:.....|.||.| .:|...|.:||.:|||.
Human    78 KQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLM 142

  Fly   125 NVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            .:|||:|||||||||||||||||||::|..|:|:.|||:
Human   143 GLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGL 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 71/110 (65%)
EMC4NP_057538.1 DUF1077 58..170 CDD:310781 71/112 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C223216803
eggNOG 1 0.900 E1_KOG3318
Hieranoid 1 1.000
Homologene 1 1.000 H5879
Inparanoid 1 1.050 166 1.000 Inparanoid score I4115
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1623701at2759
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 1 1.000 T1074546
orthoMCL 1 0.900 OOG5_128239
Panther 1 1.100 LDO PTHR19315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2002
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.