DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and emc4

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_991221.1 Gene:emc4 ZFINID:ZDB-GENE-040426-1891 Length:189 Species:Danio rerio

Alignment Length:167 Identity:88/168 (52%)
Similarity:115/168 (68%) Gaps:11/168 (7%)


  Fly     8 KKLKWALDFN----------GSKNADIPSPLGYNPSALVNQSEVVRDQRLVIKKSWDLALGPLKN 62
            |::|||::.:          ..|:.|:..|:||:...:.:.|....|:.||.|:.||:||||||.
Zfish    21 KRMKWAVELSLGNSRSRSDRQGKDGDVMYPVGYSDKPVPDTSVQEADRNLVEKRCWDVALGPLKQ 85

  Fly    63 IPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAE-GAQGTGQRIVYFLGNLANV 126
            |||||||||||||:|||||||||.||..|||:|:.:...|.|:.| .:|...|.:||.:|||...
Zfish    86 IPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMSMSATFKLLESSSQQWLQGLVYLIGNLLGS 150

  Fly   127 ALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            |||:||||||||||||:||||||::|..|||..|||:
Zfish   151 ALAIYKCQSMGLLPTHSSDWLAFIEPPQRLEIMGGGM 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 71/110 (65%)
emc4NP_991221.1 DUF1077 62..176 CDD:283955 72/114 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C223222737
eggNOG 1 0.900 E1_KOG3318
Hieranoid 1 1.000
Homologene 1 1.000 H5879
Inparanoid 1 1.050 171 1.000 Inparanoid score I4041
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1623701at2759
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 1 1.000 T1053824
orthoMCL 1 0.900 OOG5_128239
Panther 1 1.100 LDO PTHR19315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2002
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.