DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and emc4

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_988876.1 Gene:emc4 XenbaseID:XB-GENE-965547 Length:180 Species:Xenopus tropicalis

Alignment Length:169 Identity:91/170 (54%)
Similarity:116/170 (68%) Gaps:16/170 (9%)


  Fly     8 KKLKWALDF--NGSKN-------ADIPSPLGYNPSALVNQSEVVRDQRLVIKKSWDLALGPLKNI 63
            ::.|||::|  .||:.       .|...|:||:...:.:.|....|..||.|:.||:||||||.|
 Frog    13 RRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYSDKQVPDTSVQESDHILVEKRCWDIALGPLKQI 77

  Fly    64 PMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEGAQGTGQR----IVYFLGNLA 124
            |||||||||:||:|||||||||.||..|||:|:..|..|.|:.|   .:|||    :||.:|||.
 Frog    78 PMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLLE---SSGQRFLQGLVYLIGNLL 139

  Fly   125 NVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            .:|||:|||||||||||||||||||::|..|:||.|||:
 Frog   140 GLALAVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGL 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 73/113 (65%)
emc4NP_988876.1 DUF1077 55..167 CDD:310781 73/115 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C223217357
eggNOG 1 0.900 E1_KOG3318
Hieranoid 1 1.000
Homologene 1 1.000 H5879
Inparanoid 1 1.050 171 1.000 Inparanoid score I3894
OMA 1 1.010
OrthoDB 1 1.010 D1623701at2759
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 1 1.000 T1060619
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2002
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.