DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and emc4

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_588167.1 Gene:emc4 PomBaseID:SPCC1281.03c Length:193 Species:Schizosaccharomyces pombe

Alignment Length:172 Identity:63/173 (36%)
Similarity:89/173 (51%) Gaps:42/173 (24%)


  Fly     5 QNPKKLKWALDFNGSKNAD-IPSPLGYNPSALVN------------------QSEVVRDQRLVIK 50
            :.|||:   :|     |:| .|:|.|:...:||:                  :.|:.:|  |::|
pombe    19 KKPKKI---VD-----NSDKFPTPRGFQQKSLVSKNIHSGNSASSTSIFAKREEELQKD--LLLK 73

  Fly    51 KSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEG------- 108
            |:|:||..|||.||||..:.||||||:.||.||...|:|:.|:|||.:|.......:|       
pombe    74 KAWELAYSPLKQIPMNAILAYMSGNSLQIFSIMTTLMLLVNPLKAITSTGSAFTPFKGTHPGTLW 138

  Fly   109 -AQGTGQRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAF 149
             |.|     .|.|..|..:.:.:||.|.||||||..|||||:
pombe   139 PAMG-----AYILFQLLLMGIGVYKLQRMGLLPTTTSDWLAW 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 51/116 (44%)
emc4NP_588167.1 DUF1077 63..176 CDD:283955 52/121 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I1707
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 1 1.000 T1125504
orthoMCL 1 0.900 OOG5_128239
Panther 1 1.100 LDO PTHR19315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2002
TreeFam 1 0.960
98.950

Return to query results.
Submit another query.