DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and perm-3

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_500802.1 Gene:perm-3 WormBaseID:WBGene00022776 Length:174 Species:Caenorhabditis elegans

Alignment Length:162 Identity:70/163 (43%)
Similarity:97/163 (60%) Gaps:16/163 (10%)


  Fly    12 WALDFN-GSKN-----ADIPSPLGYNPSALVNQS-EVVRD----QRLVIKKSWDLALGPLKNIPM 65
            |.||:. .|||     ::...|..|:.:|.|..| |..|.    :.|..|:.||.|:||.|::||
 Worm     6 WKLDYTYSSKNCRTADSNFNPPGFYSTAATVQHSAEADRSADQHEHLARKRVWDTAMGPAKSLPM 70

  Fly    66 NLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQVTSKMAEGAQGTG----QRIVYFLGNLANV 126
            |:|:|||:|..:|||||||||||:.||:||:|....|.|..| :..||    .::::.||||..:
 Worm    71 NMFMMYMAGGGVSIFPIMMVGMMVFRPLKALFAVNSTFKPLE-SPATGSMFIHKLIFCLGNLGAI 134

  Fly   127 ALALYKCQSMGLLPTHASDWLAFVQPQTRLEY 158
            .||:||..:|||||...||||.|:....|.:|
 Worm   135 GLAIYKVHTMGLLPNTPSDWLEFIPQPGRAQY 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 56/117 (48%)
perm-3NP_500802.1 DUF1077 45..159 CDD:283955 55/115 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C222900601
eggNOG 1 0.900 E1_KOG3318
Hieranoid 1 1.000
Homologene 1 1.000 H5879
Inparanoid 1 1.050 123 1.000 Inparanoid score I3278
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1623701at2759
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 1 1.000 T474335
orthoMCL 1 0.900 OOG5_128239
Panther 1 1.100 LDO PTHR19315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2002
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.