DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC4 and LOC110438456

DIOPT Version :9

Sequence 1:NP_001303388.1 Gene:EMC4 / 40505 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_021326598.1 Gene:LOC110438456 / 110438456 -ID:- Length:70 Species:Danio rerio


Alignment Length:50 Identity:34/50 - (68%)
Similarity:41/50 - (82%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            |.:||.:|||...|||:||||||||||||:||||||::|..|||..|||:
Zfish    19 QGLVYLIGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRLEIMGGGM 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC4NP_001303388.1 DUF1077 43..152 CDD:283955 27/37 (73%)
LOC110438456XP_021326598.1 DUF1077 <6..57 CDD:310781 27/37 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623701at2759
OrthoFinder 1 1.000 - - FOG0004297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2002
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.