powered by:
Protein Alignment EMC4 and LOC110438456
DIOPT Version :9
Sequence 1: | NP_001303388.1 |
Gene: | EMC4 / 40505 |
FlyBaseID: | FBgn0037199 |
Length: | 166 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021326598.1 |
Gene: | LOC110438456 / 110438456 |
-ID: | - |
Length: | 70 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 34/50 - (68%) |
Similarity: | 41/50 - (82%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 QRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
|.:||.:|||...|||:||||||||||||:||||||::|..|||..|||:
Zfish 19 QGLVYLIGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRLEIMGGGM 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170579308 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1623701at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004297 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR19315 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2002 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.980 |
|
Return to query results.
Submit another query.