DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11137 and LOC110438456

Sequence 1:NP_001303388.1 Gene:CG11137 FlyBaseID:FBgn0037199 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_021326598.1 Gene:LOC110438456 ID: Length:70 Species:Danio rerio

Alignment Length:50 Identity:34/50 (68%)
Similarity:41/50 (82%) Gaps:0/50 (0%)


  Fly   114 QRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFVQPQTRLEYYGGGI 163
            |.:||.:|||...|||:||||||||||||:||||||::|..|||..|||:
Zfish    19 QGLVYLIGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRLEIMGGGM 68

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11137NP_001303388.1 DUF1077 43..152 CDD:283955 27/38 (71%)
LOC110438456XP_021326598.1 DUF1077 <6..57 CDD:310781 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C223220693
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1623701at2759
OrthoFinder 1 1.000 FOG0002961
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.