DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14451 and znf366

Sequence 1:NP_649410.1 Gene:CG14451 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_698186.3 Gene:znf366 ZFINID:ZDB-GENE-110408-46 Length:559 Species:Danio rerio

Alignment Length:182 Identity:46/183 (25%)
Similarity:67/183 (37%) Gaps:50/183 (27%)


  Fly    22 CEWCGKVYKSLVRYHNHIVCTHKLPVPDHQLVNCFHCPRSDCRFHKHGPGVQNFRQIGRLRRHYQ 86
            |..|||::|.|...|.|:: ||:...| |:...|          ||      .|.|...|:||..
Zfish   179 CSLCGKLFKQLSHLHTHML-THQGTRP-HKCQVC----------HK------AFTQTSHLKRHMM 225

  Fly    87 EKHMTGHLTCEYCQKQFQLKSALVAH-------------RCRLRHPAIRDSQSAITLGR------ 132
            :.......:|..|.:.|...|.|.||             .|.|..|.:...:..:|..|      
Zfish   226 QHSDVKPYSCSVCGRGFAYPSELRAHELKHERGQENVCVECGLDFPTLAQLKRHLTAHRGPVQYA 290

  Fly   133 -HVCKKGYTHLGALQRRLTCCQHGTPNTPTEDQKDIRDTVCLQCNKEYVDTH 183
             ..|.|.:.:...||..:  .:|          ||||..:|.:|..|:|.:|
Zfish   291 CSECGKSFQYPSQLQNHM--MKH----------KDIRPFICSECGMEFVQSH 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14451NP_649410.1 None
znf366XP_698186.3 C2H2 Zn finger 151..171 CDD:275368
C2H2 Zn finger 179..199 CDD:275368 9/21 (43%)
zf-C2H2 205..227 CDD:278523 9/38 (24%)
C2H2 Zn finger 207..227 CDD:275368 8/36 (22%)
C2H2 Zn finger 235..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 263..283 CDD:275368 4/20 (20%)
COG5048 <288..431 CDD:227381 14/56 (25%)
C2H2 Zn finger 291..311 CDD:275368 4/22 (18%)
C2H2 Zn finger 319..339 CDD:275368 5/13 (38%)
C2H2 Zn finger 347..367 CDD:275368
C2H2 Zn finger 375..395 CDD:275368
C2H2 Zn finger 403..423 CDD:275368
C2H2 Zn finger 431..450 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.