DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14451 and Zfp366

Sequence 1:NP_649410.1 Gene:CG14451 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001004149.1 Gene:Zfp366 MGIID:2178429 Length:746 Species:Mus musculus

Alignment Length:177 Identity:50/178 (28%)
Similarity:70/178 (39%) Gaps:40/178 (22%)


  Fly    22 CEWCGKVYKSLVRYHNHIVCTHKLPVPDHQLVNCFHCPRSDCRFHKHGPGVQNFRQIGRLRRHYQ 86
            |..|||::|.|...|.|:: ||:...| |:...|          ||      .|.|...|:||..
Mouse   280 CSRCGKLFKQLSHLHTHML-THQGTRP-HKCQVC----------HK------AFTQTSHLKRHMM 326

  Fly    87 EKHMTGHLTCEYCQKQFQLKSALVAHRCRLRHPAIR---------DSQSAITLGRHVCKKGYTHL 142
            :........|..|.:.|...|.|.||..  :|.:.|         |..:...|.||:.    ||.
Mouse   327 QHSEVKPHNCRVCSRGFAYPSELKAHEA--KHASGRENICVECGLDFPTLAQLKRHLT----THR 385

  Fly   143 GALQRRLTCCQHGTPNTPTEDQ------KDIRDTVCLQCNKEYVDTH 183
            |.:|...:.|.. |...|::.|      ||||..:|.:|..|:|..|
Mouse   386 GPIQYNCSECDK-TFQYPSQLQNHMMKHKDIRPYICSECGMEFVQPH 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14451NP_649410.1 None
Zfp366NP_001004149.1 FtsK <51..>227 CDD:332908
COG5048 250..>546 CDD:227381 50/178 (28%)
C2H2 Zn finger 252..272 CDD:275368
C2H2 Zn finger 280..300 CDD:275368 9/21 (43%)
C2H2 Zn finger 308..328 CDD:275368 8/36 (22%)
C2H2 Zn finger 336..356 CDD:275368 7/22 (32%)
C2H2 Zn finger 364..384 CDD:275368 5/24 (21%)
C2H2 Zn finger 392..412 CDD:275368 4/21 (19%)
C2H2 Zn finger 420..440 CDD:275368 5/13 (38%)
C2H2 Zn finger 448..468 CDD:275368
Interaction with NRIP1. {ECO:0000250|UniProtKB:Q8N895} 452..746
C2H2 Zn finger 476..496 CDD:275368
C2H2 Zn finger 504..524 CDD:275368
C2H2 Zn finger 532..551 CDD:275368
PXDLS. {ECO:0000250|UniProtKB:Q8N895} 587..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.