DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14451 and pag-3

Sequence 1:NP_649410.1 Gene:CG14451 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_510480.1 Gene:pag-3 WormBaseID:WBGene00003909 Length:336 Species:Caenorhabditis elegans

Alignment Length:194 Identity:40/195 (21%)
Similarity:60/195 (31%) Gaps:64/195 (33%)


  Fly    20 FCCEWCGKVYKSLVRYHNHIVCTHKLPVPDHQLVNCFHCPRSDCRFHKHGPGVQNFRQIGRLRRH 84
            |.|:.|.|::.::.....|    .::.|.|.|. .|..|.::             |::...|..|
 Worm   126 FHCQKCTKLFSTIAALEQH----QQVHVSDKQF-ECKQCGKT-------------FKRSSTLSTH 172

  Fly    85 YQEKHMTGHLTCEYCQKQFQLKSALVAHRCRLRHPAIRDSQSAITLGRHVCKKGYTHLGALQRRL 149
            ......|....||||.|:|..||.:..|.                         |.|.|....:.
 Worm   173 LLIHSDTRPYPCEYCGKRFHQKSDMKKHT-------------------------YIHTGEKPHKC 212

  Fly   150 TCC-----QHGTPNTPTEDQKDIRDTVCLQCNKEYVDTHRCCVRTERSFQSDRLIFRKSSQETH 208
            |.|     |.....|.|......:...|..|.              |:||  |.:.|:..:|:|
 Worm   213 TVCGKAFSQSSNLITHTRKHTGFKPFACDVCG--------------RTFQ--RKVDRRRHRESH 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14451NP_649410.1 None
pag-3NP_510480.1 C2H2 Zn finger 128..148 CDD:275368 4/24 (17%)
zf-H2C2_2 140..165 CDD:290200 7/43 (16%)
zf-C2H2 154..176 CDD:278523 5/36 (14%)
C2H2 Zn finger 156..176 CDD:275368 5/33 (15%)
COG5048 164..>233 CDD:227381 20/94 (21%)
zf-H2C2_2 169..193 CDD:290200 9/24 (38%)
C2H2 Zn finger 184..204 CDD:275368 10/45 (22%)
zf-H2C2_2 196..221 CDD:290200 6/50 (12%)
C2H2 Zn finger 212..232 CDD:275368 5/20 (25%)
zf-H2C2_2 224..247 CDD:290200 5/37 (14%)
C2H2 Zn finger 240..260 CDD:275368 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.