DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14451 and zfp-2

Sequence 1:NP_649410.1 Gene:CG14451 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_496055.1 Gene:zfp-2 WormBaseID:WBGene00009448 Length:422 Species:Caenorhabditis elegans

Alignment Length:250 Identity:56/250 (22%)
Similarity:82/250 (33%) Gaps:77/250 (31%)


  Fly    16 DELGFCCEWCGKVYKSLVRYHNHIVCTHKLPVPDHQLV----NCFHCPR------SDCRFHK-H- 68
            |...|.|..||      :|:.|....||.|  .||.|:    :|.:|||      |..|.|| | 
 Worm   196 DARPFRCFNCG------MRFANKTSMTHHL--KDHSLLKPMFSCDYCPRIFSKLESKTRHHKMHF 252

  Fly    69 -----GPGVQNFRQIGRLRRHYQEKH-----------------MTGHLTCEYCQKQFQLKSALVA 111
                 ...::.|.....||.|....|                 .:...:|.||..:|..|..::.
 Worm   253 TRSTCQTCMRFFTTEDALRHHQSTAHPATFDSGPPPEDLLPNGKSARYSCSYCNLRFHFKKDMLV 317

  Fly   112 HRCRLRHPAIRDSQSAITLGRHVCKKGYTHLGALQRRLTCCQHGTPNTPTEDQKDIRDTVCLQCN 176
            |.      .|...:...:.|  .|.|.:....||...:        .|.|::    ....|.:|:
 Worm   318 HE------RIHTGEKPYSCG--YCMKSFAQSQALTAHI--------RTHTKE----LPYGCGKCD 362

  Fly   177 KEYVDTHRCCVRTERSFQSDRLIFRKSS--------------QETHGKSRYLQAE 217
            |.:.| :.|..:.|.:..:|..|.|..|              :|...|...|.||
 Worm   363 KRFRD-NSCLRKHELAAHTDEPIVRPISVAYSNQVQKQMQRQRENRRKQELLIAE 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14451NP_649410.1 None
zfp-2NP_496055.1 C2H2 Zn finger 173..194 CDD:275368
C2H2 Zn finger 202..222 CDD:275368 9/28 (32%)
C2H2 Zn finger 231..251 CDD:275368 8/20 (40%)
COG5048 <251..>358 CDD:227381 20/127 (16%)
C2H2 Zn finger 257..278 CDD:275368 4/21 (19%)
C2H2 Zn finger 302..322 CDD:275368 7/26 (27%)
C2H2 Zn finger 330..350 CDD:275368 6/30 (20%)
C2H2 Zn finger 358..374 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.