DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14451 and ZNF366

Sequence 1:NP_649410.1 Gene:CG14451 FlyBaseID:FBgn0037183 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_689838.1 Gene:ZNF366 HGNCID:18316 Length:744 Species:Homo sapiens

Alignment Length:177 Identity:50/178 (28%)
Similarity:70/178 (39%) Gaps:40/178 (22%)


  Fly    22 CEWCGKVYKSLVRYHNHIVCTHKLPVPDHQLVNCFHCPRSDCRFHKHGPGVQNFRQIGRLRRHYQ 86
            |..|||::|.|...|.|:: ||:...| |:...|          ||      .|.|...|:||..
Human   283 CTHCGKLFKQLSHLHTHML-THQGTRP-HKCQVC----------HK------AFTQTSHLKRHMM 329

  Fly    87 EKHMTGHLTCEYCQKQFQLKSALVAHRCRLRHPAIR---------DSQSAITLGRHVCKKGYTHL 142
            :........|..|.:.|...|.|.||..  :|.:.|         |..:...|.||:.    ||.
Human   330 QHSEVKPHNCRVCGRGFAYPSELKAHEA--KHASGRENICVECGLDFPTLAQLKRHLT----THR 388

  Fly   143 GALQRRLTCCQHGTPNTPTEDQ------KDIRDTVCLQCNKEYVDTH 183
            |.:|...:.|.. |...|::.|      ||||..:|.:|..|:|..|
Human   389 GPIQYNCSECDK-TFQYPSQLQNHMMKHKDIRPYICSECGMEFVQPH 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14451NP_649410.1 None
ZNF366NP_689838.1 COG5048 253..>549 CDD:227381 50/178 (28%)
C2H2 Zn finger 255..275 CDD:275368
C2H2 Zn finger 283..303 CDD:275368 9/21 (43%)
C2H2 Zn finger 311..331 CDD:275368 8/36 (22%)
C2H2 Zn finger 339..359 CDD:275368 7/22 (32%)
C2H2 Zn finger 367..387 CDD:275368 5/24 (21%)
C2H2 Zn finger 395..415 CDD:275368 4/21 (19%)
C2H2 Zn finger 423..443 CDD:275368 5/13 (38%)
C2H2 Zn finger 451..471 CDD:275368
Interaction with NRIP1. {ECO:0000269|PubMed:17085477} 455..744
C2H2 Zn finger 479..499 CDD:275368
C2H2 Zn finger 507..527 CDD:275368
C2H2 Zn finger 535..554 CDD:275368
PXDLS. {ECO:0000269|PubMed:16393996, ECO:0000269|PubMed:17085477} 590..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.