DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33632

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:116 Identity:26/116 - (22%)
Similarity:45/116 - (38%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP----IAKGR 129
            |.|:..:..:.:.|.....|.||:.||.|...|.:|:..:.:...:::.||..|||    :....
  Fly    72 IKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDE 136

  Fly   130 YHWHRIHLKRKLQGSYFINKFWWPEDPTTAMLP----ELEFEIIWQAMHVD 176
            ..:|.|:.|                  .|.:||    ..:.|:.|.|..:|
  Fly   137 MSYHSINYK------------------LTEILPFPEGNYKLEVHWIAYDID 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 24/103 (23%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 20/98 (20%)

Return to query results.
Submit another query.