DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33632

DIOPT Version :8

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:116 Identity:26/117 (22%)
Similarity:45/117 (38%) Gaps:26/117 (22%)


  Fly    69 IHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP----IAKGR 129
            |.|:..:..:.:.|.....|.||:.||.|...|.:|:..:.:...:::.||..|||    :....
  Fly    72 IKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDE 136

  Fly   130 YHWHRIHLKRKLQGSYFINKFWWPEDPTTAMLP----ELEFEIIWQAMHVD 176
            ..:|.|:.|                  .|.:||    ..:.|:.|.|..:|
  Fly   137 MSYHSINYK------------------LTEILPFPEGNYKLEVHWIAYDID 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 24/104 (23%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48695
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.