DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33658

DIOPT Version :8

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster

Alignment Length:113 Identity:22/114 (19%)
Similarity:43/114 (38%) Gaps:38/114 (33%)


  Fly    54 LNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGN 118
            :||.:  ||::            |...|:.   .|.|::.|:.:.....:.|.::.:.|||...|
  Fly    75 VNFGL--HQQI------------NGYKPFL---YNITIDGCQFMKNTKSNVVAKYFYDFIRNISN 122

  Fly   119 IVETCPIAKGRYHWHRIHLKRKLQ---------------GSYFINKFW 151
            :..:||     |: |.|.:::...               |:|....:|
  Fly   123 LNHSCP-----YN-HDIIMEKLTSETINSRLPKTLPFPTGNYMFQTYW 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 16/86 (19%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48706
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.