DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33658

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:113 Identity:22/113 - (19%)
Similarity:43/113 - (38%) Gaps:38/113 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGN 118
            :||.:  ||::            |...|:.   .|.|::.|:.:.....:.|.::.:.|||...|
  Fly    75 VNFGL--HQQI------------NGYKPFL---YNITIDGCQFMKNTKSNVVAKYFYDFIRNISN 122

  Fly   119 IVETCPIAKGRYHWHRIHLKRKLQ---------------GSYFINKFW 151
            :..:||     |: |.|.:::...               |:|....:|
  Fly   123 LNHSCP-----YN-HDIIMEKLTSETINSRLPKTLPFPTGNYMFQTYW 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 16/85 (19%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 17/84 (20%)

Return to query results.
Submit another query.