DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33679

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:68 Identity:21/68 - (30%)
Similarity:34/68 - (50%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VHQELHDVDIH-VEVR-IT-NKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVE 121
            :|.:|..:.|: :.|| || .|.:.|:....|.:...||:|.:.|:..|..:.:.....|.||..
  Fly    53 IHVKLLKLPINRMVVRFITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINH 117

  Fly   122 TCP 124
            |||
  Fly   118 TCP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 13/43 (30%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 16/51 (31%)

Return to query results.
Submit another query.