DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33914

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:85 Identity:19/85 - (22%)
Similarity:35/85 - (41%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTY----SLTNYNVDEEMLPSFLPEAKF 156
            |:.|:..|..::. |.|.::|.:..|..:...||.....|    .|||..|..::....:|:..:
  Fly   101 LDLCRFWKNHHNH-LARMVFEFIDGHTNMNHTCPYTKEKYISIDDLTNTEVSAKIRGVPMPKGFY 164

  Fly   157 RFGMKISTDKGGMIVRSTIF 176
            ......||:....:|.:..|
  Fly   165 ALFTTWSTENITRVVTNFYF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 19/85 (22%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 15/65 (23%)

Return to query results.
Submit another query.