DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33771

DIOPT Version :8

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster

Alignment Length:162 Identity:31/163 (19%)
Similarity:73/163 (45%) Gaps:19/163 (12%)


  Fly    14 FILVALMPLTGAWRSFKVILTSIDFEANDK-FLDLKVDLQNDSGESNLSIDIKTHQDIE-DVQLV 76
            |:||.|:..|........:..:.:...|.| |.:..:.:.|::    :::|:..::.|: ..:..
  Fly     8 FLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNT----MNMDMHLNRPIQRGFKAH 68

  Fly    77 VDFGLE-TDKGNYSTLINRTLNFCKLMKQ-RNSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTN 139
            ||..|. .:..|:.::.::..:.|.:... :||  |.::.::|:.|:......||:..|.|.:.:
  Fly    69 VDILLRLANAKNFQSMFSQKSDVCAVTSSVKNS--LFKSWFKDMSKNSNFMYNCPVEVGHYYMHD 131

  Fly   140 YNVDEEMLPSFLPEAKFR---------FGMKI 162
            :.:...|...||...::|         :|.|:
  Fly   132 WRMGSSMTHKFLIPGEYRGKLTFFYGKYGTKL 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 17/87 (20%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47772
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.