DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33703

DIOPT Version :8

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster

Alignment Length:127 Identity:28/128 (22%)
Similarity:60/128 (47%) Gaps:8/128 (6%)


  Fly    44 FLDLKVDLQNDSGESNLSI-DIKTHQD-IEDVQLVVDFGL-ETDKGNYSTLINRTLNFCKLMKQR 105
            |...|| ::.::|.:.|.: ::..::| |:|:  |::.|: ...|......:|.||::|...:|.
  Fly    41 FKTCKV-VRRENGRAALYVSEVFLYKDPIDDI--VLNLGVFRIAKNRRFQFLNETLDYCLFSRQY 102

  Fly   106 NSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPSF-LPEAKFRFGMKISTDK 166
            .:......:...||:...|...||::. ..:...::|||..:... :|...:.|.::.|..|
  Fly   103 LASGFFGFLMTPLLRISNLNATCPLQQ-NITFNGFSVDENTIKEIPIPNGVYMFHLRSSLMK 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 17/82 (21%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.