DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trxr-2 and AT4G16155

Sequence 1:NP_524216.1 Gene:Trxr-2 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_567487.5 Gene:AT4G16155 AraportID:AT4G16155 Length:567 Species:Arabidopsis thaliana

Alignment Length:556 Identity:137/557 (25%)
Similarity:224/557 (40%) Gaps:103/557 (18%)


  Fly     4 IKFLRSSTHNALRSSLGWCRLAASRPRYDYDLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTP 68
            |:..|.....|..||.|   ..|....:||||:::|.|..|...|..|...|.:....:      
plant    59 IQSRRIEVSAAASSSAG---NGAPSKSFDYDLIIIGAGVGGHGAALHAVEKGLKTAIIE------ 114

  Fly    69 VGTKWG--IGGTCVNVGCIPKKLMHQAS-----LLGEAVHEAVAYGWNV-----DDTNIRPDWRK 121
                 |  :||||||.||:|.|.:...|     |..|  |...|:|..|     |...:......
plant   115 -----GDVVGGTCVNRGCVPSKALLAVSGRMRELQNE--HHMKAFGLQVSAAGYDRQGVADHASN 172

  Fly   122 LVRSVQNHIKSVNWVTRVD--------LRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEY 178
            |...::|::.:......||        |..:||:|.:::.|.:|                     
plant   173 LATKIRNNLTNSMKALGVDILTGFGAVLGPQKVKYGDNIITGKD--------------------- 216

  Fly   179 VVVAVGGRPRYPDIPGAVELG----ITSDDIFSYEREPGRTLVVGAGYVGLECACFLKGLGYEPT 239
            :::|.|.   .|.:|..:|:.    ||||.....|..|....:||:||:|||.:.....||.|.|
plant   217 IIIATGS---VPFVPKGIEVDGKTVITSDHALKLESVPDWIAIVGSGYIGLEFSDVYTALGSEVT 278

  Fly   240 -VMVRSIVLRGFDRQMSELL-AAMMTERGIPFLGTTIPKAVERQADGR-LLVRYRNTTTQ--MDG 299
             :.....::.|||.::|:|. ..::..|.|.:........:....||: :|:...:..|:  .|.
plant   279 FIEALDQLMPGFDPEISKLAQRVLINTRKIDYHTGVFASKITPAKDGKPVLIELIDAKTKEPKDT 343

  Fly   300 SDVFDTVLWAIGRKGLIEDLNLDAAGVKTH------DDKIVVDAAEATSVPHIFAVGDIIYGRPE 358
            .:| |..|.|.||......|.|:...|.|.      |:::.|.......|||::.:|| ..|:..
plant   344 LEV-DAALIATGRAPFTNGLGLENINVTTQRGFIPVDERMRVIDGNGKLVPHLYCIGD-ANGKLM 406

  Fly   359 LTPVAILSGRLLARRLFAGSTQLMDYADVATTVFTPLEYSCVGMSEETAIELRGADNIEVFHGYY 423
            |...|...|..:..:: .|...::::..:....||..|.|.||::|..|.|....:..:|     
plant   407 LAHAASAQGISVVEQV-TGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFKV----- 465

  Fly   424 KPTEFFIPQKSVRHCYLKAVAEVSGD-----------QKILGLHYIGPVAGEVIQGFAAALKTGL 477
                 .|.:.|.: ...||:||..|:           .:|||:|..|..|.::|...:.|:..|.
plant   466 -----SIAKTSFK-ANTKALAENEGEGLAKMIYRPDNGEILGVHIFGLHAADLIHEASNAIALGT 524

  Fly   478 TVKTLLNTVGIHPTTAEEFTRLSITKRSGRDPTPAS 513
            .::.:...|..|||.:|....|.   ::.:..:|||
plant   525 RIQDIKLAVHAHPTLSEVVDELF---KAAKVDSPAS 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 10/39 (26%)
TGR 31..515 CDD:273624 130/530 (25%)
NADB_Rossmann <144..239 CDD:304358 26/99 (26%)
Pyr_redox 214..288 CDD:278498 21/77 (27%)
Pyr_redox_dim 388..497 CDD:280934 31/120 (26%)
AT4G16155NP_567487.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D581771at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.